Recombinant Rickettsia canadensis Probable intracellular septation protein A (A1E_03430)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rickettsia canadensis Probable Intracellular Septation Protein A (A1E_03430)

Recombinant Rickettsia canadensis Probable intracellular septation protein A (A1E_03430) is a bioengineered protein derived from the obligate intracellular bacterium Rickettsia canadensis. This protein is synthesized in heterologous systems (e.g., E. coli) for research applications, including diagnostic assays and studies on rickettsial pathogenesis. Its designation as a "probable intracellular septation protein" suggests a role in bacterial cell division or host cell manipulation during replication, though specific functional studies remain limited.

Production and Purity

  • Source: Expressed in E. coli with an N-terminal His-tag for purification.

  • Purity: >90% by SDS-PAGE, confirmed via chromatography.

  • Storage: Lyophilized powder in Tris-based buffer with 6% trehalose; stored at -20°C or -80°C .

Hypothetical Role in Rickettsial Biology

While direct functional data for A1E_03430 are sparse, analogous proteins in other Rickettsia species (e.g., Rickettsia rickettsii A1G_03060) are linked to intracellular survival mechanisms:

ProteinSpeciesProposed FunctionSupporting Evidence
A1E_03430R. canadensisSeptation/cell division regulationSequence homology to septation proteins
A1G_03060R. rickettsiiMembrane-spanning protein (yciB)Structural prediction
RARP2R. rickettsiiDisrupts trans-Golgi network traffickingExperimental validation
RLipR. rickettsiiLipase activity; cytosolic colonizationEnzymatic assays, secretion profiling

Diagnostic and Research Utility

  • ELISA Development: Used as a target antigen in serological assays to detect anti-Rickettsia antibodies .

  • Pathogenesis Studies: Potential model for investigating septation-related virulence mechanisms, though no direct evidence exists.

  • Comparative Genomics: Aligns with conserved indels in Rickettsia genomes (e.g., FtsZ insertions), suggesting genus-wide functional importance .

Challenges and Knowledge Gaps

  1. Functional Characterization: No experimental data confirm its role in septation or pathogenesis.

  2. Secretion Pathway: Unlike autotransporters (e.g., Sca1, OmpA) or T4SS effectors (e.g., Risk1), A1E_03430’s secretion mechanism remains undefined .

  3. Strain-Specific Variability: Limited genomic data for R. canadensis hinder comparative analysis with virulent Rickettsia species (e.g., R. rickettsii) .

Future Directions

  • Knockout Studies: Generate R. canadensis mutants to assess A1E_03430’s impact on growth and host cell invasion.

  • Proteomic Profiling: Identify interacting partners in host cells to elucidate its role in pathogenesis.

  • Diagnostic Validation: Test recombinant A1E_03430 in ELISA assays against clinical sera to evaluate diagnostic utility.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; A1E_03430; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Rickettsia canadensis (strain McKiel)
Target Names
A1E_03430
Target Protein Sequence
MLKLLSEIGPVIAFFAGFFYGGGIQNATLYMLITAIICVTICYFVDKKVSKLSIISVSVL LVSGIITLISGNSIYIKIKPTILYVIFGIIFLMSGIRKNPFIKYALESIVRLKEESWITL SYRAAAFFFFMAVVNEIVWRNFSDETWVKFKVFGVIPITFIFILLQLPLLLKNKLPDSKI
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintenance of cell envelope integrity, and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rickettsia canadensis and how does it relate to other Rickettsia species?

Rickettsia canadensis is a species within the genus Rickettsia, initially isolated from Haemaphysalis leporispalustris ticks collected from Ontario, Canada in 1962 and subsequently from specimens collected in California in 1980. Phylogenetically, R. canadensis shares characteristics with both the typhus group and spotted fever group (SFG) rickettsiae, potentially resembling ancestral forms of the genus Rickettsia . Unlike many pathogenic Rickettsia species, R. canadensis has no confirmed cases of human disease, though serological studies suggest possible human infections . As an obligate intracellular bacterium, it cannot grow in artificial nutrient culture and must be cultivated in tissue or embryo cultures, typically using chicken embryos .

What is the function of intracellular septation protein A in bacterial cells?

Intracellular septation proteins play critical roles in bacterial cell division. Based on research on similar proteins, the probable intracellular septation protein A (A1E_03430) in R. canadensis likely participates in the septation initiation network (SIN), which coordinates cell division processes. These proteins typically localize to the septation site, forming a ring structure that gradually accumulates at the central region during cell division . Septation proteins function through signaling cascades involving phosphorylation/dephosphorylation reactions that regulate protein activity and subcellular localization during septum formation . In many bacteria, septation proteins are essential for proper cellular division and viability.

How are recombinant Rickettsia proteins typically expressed and purified?

Methodological approach: Expression of recombinant Rickettsia proteins presents unique challenges due to their intracellular nature. The recommended approach involves:

  • Gene synthesis or PCR amplification of the target gene (A1E_03430) from R. canadensis genomic DNA

  • Cloning into an appropriate expression vector with an affinity tag (typically 6xHis or GST)

  • Expression in E. coli systems (BL21, Rosetta, or Arctic Express strains) with optimization of temperature (typically 18-30°C) and IPTG concentration (0.1-1.0 mM)

  • Cell lysis under native conditions using sonication or French press

  • Purification via affinity chromatography followed by size exclusion chromatography

  • Verification of protein purity via SDS-PAGE and Western blot

For particularly challenging expressions, insect cell expression systems (Sf9 or High Five cells) can provide better folding and solubility for Rickettsia proteins.

How can I determine the subcellular localization of Rickettsia canadensis septation protein A?

To determine subcellular localization, researchers should employ multiple complementary approaches:

  • Fluorescent protein fusion approach: Generate GFP-tagged constructs of A1E_03430 and express in an appropriate model system. Based on research with similar proteins like MztA, you would expect localization at the spindle pole body (SPB) and septum site in mature cells under induced conditions .

  • Immunofluorescence microscopy: Develop specific antibodies against A1E_03430 and use them for immunolabeling in fixed R. canadensis cells or in heterologous expression systems.

  • Subcellular fractionation: Separate bacterial cellular components through differential centrifugation followed by Western blot analysis of each fraction.

  • Co-localization studies: Examine co-localization with known septation markers, such as FtsZ or other SIN pathway components.

The combination of these techniques provides robust evidence for protein localization. Expect potential localization at the septum site, forming ring-like structures during cell division, similar to other septation proteins like MobA .

What experimental controls should be included when studying A1E_03430 function?

Control TypePurposeImplementation
Positive controlsValidate experimental systemInclude well-characterized septation proteins (e.g., FtsZ, SepF)
Negative controlsRule out non-specific effectsUse vector-only or non-related protein expression
Expression controlsVerify protein productionWestern blot analysis with tag-specific antibodies
Localization controlsConfirm specificity of localizationInclude proteins with known distinct localization patterns
Functional complementationVerify functional conservationExpress A1E_03430 in heterologous systems with septation defects
Domain mutantsMap functional regionsGenerate point mutations in predicted functional domains
Conditional expressionTemporal controlUse inducible/repressible promoters (e.g., tetracycline-regulated)

When designing deletion or conditional strains, diagnostic PCR should confirm correct integration of gene cassettes at the predicted genomic sites .

How does the septation process in Rickettsia compare to other bacterial systems?

Septation in Rickettsia appears to share core elements with other bacterial systems but likely contains unique adaptations related to its obligate intracellular lifestyle. In Rickettsia, as in other bacteria, septation involves:

  • Assembly of a septation ring at the division site

  • Recruitment of SIN pathway components

  • Coordination with chromosome segregation

  • Inward growth of the septum

  • Cell wall synthesis at the division site

  • Integration with host cell processes due to intracellular lifestyle

  • Potential interactions with host cytoskeleton components

  • Adaptations to the constrained space within host cells

  • Specialized mechanisms for maintaining obligate intracellular replication

The study of septation proteins in Rickettsia provides insights into how these obligate intracellular bacteria have adapted fundamental cellular processes to their specialized lifestyle .

What is the role of A1E_03430 in the Rickettsia septation initiation network (SIN)?

Based on studies of septation in related systems, A1E_03430 likely functions as a positive regulator in the septation process. Similar proteins like MztA have been shown to influence septation through the SIN pathway . The protein may coordinate with other regulatory components such as ParA, which has been demonstrated to affect recruitment of SIN components during septation .

Proposed experimental approach to determine SIN pathway interactions:

  • Generate conditional mutants of A1E_03430 using an alcohol-regulated promoter system

  • Perform co-immunoprecipitation studies to identify interacting partners

  • Conduct phosphorylation studies to identify post-translational modifications

  • Analyze the effects of A1E_03430 deletion on localization of known SIN components

  • Perform genetic suppressor screens to identify functional interactions

  • Establish the hierarchy of recruitment of septation proteins through time-lapse microscopy

Advanced researchers should note that A1E_03430 may function similarly to MztA homologous proteins in other organisms, potentially as a component of γ-tubulin ring complexes (γ-TuRCs) essential for recruitment to microtubule-organizing centers .

How do phosphorylation/dephosphorylation dynamics regulate A1E_03430 function?

The function of septation proteins is often regulated through complex phosphorylation and dephosphorylation events. Based on research on related septation systems, A1E_03430 activity may be controlled through:

  • Phosphorylation by SIN kinases: Three protein kinases typically regulate SIN signaling through phosphorylation events that control protein activity and subcellular localization .

  • Dephosphorylation by protein phosphatases: Counteracting phosphatases, particularly PP2A family phosphatases, likely regulate A1E_03430. These include serine/threonine phosphatases, protein tyrosine phosphatases, and aspartate-based catalysis protein phosphatases .

  • Spatial regulation: Phosphorylation state may determine subcellular localization between spindle pole body and septation site.

Experimental approach for phosphorylation studies:

  • Identify phosphorylation sites using mass spectrometry

  • Generate phosphomimetic and phosphonull mutants

  • Analyze effects on protein localization and function

  • Identify interacting kinases and phosphatases

  • Establish temporal dynamics of phosphorylation during cell cycle

Understanding these regulatory mechanisms is critical for elucidating the precise function of A1E_03430 in the septation process.

How has A1E_03430 evolved across Rickettsia species and what does this reveal about functional conservation?

Evolutionary analysis of septation proteins across Rickettsia species provides insights into functional conservation and adaptation. Research approaches should include:

  • Comparative genomic analysis: Identify orthologs of A1E_03430 across different Rickettsia species and related genera.

  • Sequence conservation analysis: Determine the degree of sequence conservation across:

    • Pathogenic vs. non-pathogenic Rickettsia species

    • Typhus group vs. spotted fever group rickettsiae

    • Arthropod-specific vs. vertebrate-infecting species

  • Selection pressure analysis: Calculate Ka/Ks ratios to determine if the protein is under purifying or positive selection.

  • Recombination analysis: Examine evidence for recombination events in A1E_03430 evolution, which may contribute to adaptive evolution in Rickettsia antigens .

  • Functional conservation testing: Express orthologs from different species in heterologous systems to test functional complementation.

This evolutionary perspective helps researchers understand how intracellular bacteria like Rickettsia maintain and adapt essential cellular processes across diverse ecological niches .

What are the challenges in expressing recombinant Rickettsia proteins and how can they be overcome?

Common challenges and solutions:

ChallengeSolution
Toxic effects in E. coliUse tight expression control systems (e.g., T7lac, araBAD)
Protein insolubilityTest multiple fusion tags (MBP, SUMO, TRX)
Low expression levelsOptimize codon usage for expression host
Improper foldingExpress at lower temperatures (16-20°C)
Post-translational modificationsConsider eukaryotic expression systems
Protein instabilityAdd protease inhibitors during purification
Contamination with host proteinsDesign stringent purification schemes
Functional validationDevelop appropriate activity assays

For A1E_03430 specifically, researchers should consider:

  • Testing expression as fragments if the full-length protein proves challenging

  • Using bacterial expression systems optimized for toxic/membrane proteins

  • Employing cell-free expression systems if cellular toxicity is an issue

  • Co-expressing potential binding partners to improve solubility

How can structural studies of A1E_03430 be approached given the challenges of crystallizing bacterial septation proteins?

Structural characterization of septation proteins presents significant challenges. A multi-technique approach is recommended:

  • X-ray crystallography preparation:

    • Express protein with removable affinity tags

    • Perform limited proteolysis to identify stable domains

    • Screen extensively for crystallization conditions

    • Consider co-crystallization with binding partners

  • Cryo-electron microscopy:

    • Particularly useful for larger protein complexes

    • May reveal dynamic structural transitions during septation

  • Nuclear magnetic resonance (NMR):

    • Suitable for smaller domains (<25 kDa)

    • Can provide dynamics information

  • Small-angle X-ray scattering (SAXS):

    • Provides low-resolution structural information

    • Useful for flexible proteins or multi-domain arrangements

  • Computational approaches:

    • Homology modeling based on related proteins

    • Molecular dynamics simulations

    • Protein-protein docking predictions

The integration of structural data with functional studies will provide mechanistic insights into how A1E_03430 contributes to the septation process in Rickettsia canadensis.

How does A1E_03430 interact with host cell components during Rickettsia infection?

As an obligate intracellular bacterium, Rickettsia canadensis likely coordinates its cell division with processes in the host cell. Future research should investigate:

  • Host cytoskeleton interactions: Determine if A1E_03430 interacts with host microtubules or microfilaments during bacterial replication.

  • Host cell cycle coordination: Explore whether R. canadensis septation is synchronized with host cell cycle phases.

  • Membrane interaction studies: Investigate potential interactions between A1E_03430 and host cell membranes.

  • Immunomodulation: Examine whether A1E_03430 plays a role in evading host immune responses during bacterial replication.

  • Comparative studies: Contrast interactions in tick cells versus mammalian cells to understand host-specific adaptations.

Methodological approaches should include co-immunoprecipitation from infected cells, proximity labeling techniques (BioID, APEX), and live-cell imaging of fluorescently tagged proteins.

What emerging technologies can advance the study of Rickettsia septation proteins?

The study of Rickettsia proteins benefits from several emerging technologies:

  • CRISPR-Cas systems adapted for intracellular bacteria: Development of genetic manipulation tools specifically for obligate intracellular bacteria.

  • Single-cell approaches: Technologies that allow study of Rickettsia within individual host cells:

    • Single-cell RNA-seq of infected host cells

    • Microscopy with super-resolution capabilities

    • Microfluidic devices for single-cell analysis

  • Advanced protein interaction mapping:

    • Proximity-dependent biotinylation (BioID, TurboID)

    • Thermal proximity coaggregation (TPCA)

    • Crosslinking mass spectrometry

  • Integrative structural biology:

    • Combination of cryo-EM, crystallography, and computational modeling

    • Time-resolved structural studies

  • Systems biology approaches:

    • Multi-omics integration (proteomics, transcriptomics, metabolomics)

    • Network modeling of septation processes

These technologies promise to overcome the significant challenges in studying proteins from obligate intracellular bacteria like Rickettsia canadensis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.