Recombinant Rickettsia conorii DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rickettsia conorii DNA Translocase FtsK

Recombinant Rickettsia conorii DNA translocase FtsK (ftsK) is a crucial protein involved in DNA translocation and chromosome segregation in the bacterium Rickettsia conorii, which is known to cause Mediterranean spotted fever. This protein plays a significant role in the maintenance of genomic integrity during cell division by facilitating the movement of DNA across cellular membranes and ensuring proper chromosome unlinking.

Function and Mechanism of FtsK

FtsK is classified as a DNA motor protein that utilizes ATP hydrolysis to translocate along duplex DNA. It is essential for coupling chromosome segregation with cell division, acting primarily at the bacterial division septum. The FtsK protein operates by:

  • Translocating DNA: It pumps double-stranded DNA directionally at approximately 5 kb/s.

  • Activating Recombination: FtsK activates XerCD site-specific recombination, which is critical for unlinking chromosomes during cell division. This process involves the formation of Holliday junctions that are resolved by XerC, leading to the separation of linked chromosomes into monomers .

Research Findings on Recombinant FtsK

Recent studies have focused on the recombinant expression and functional analysis of ftsK from Rickettsia conorii. Key findings include:

  • Gene Cloning and Expression: The ftsK gene has been successfully cloned and expressed in various systems, enabling detailed studies of its biochemical properties.

  • Mutational Analysis: Mutations in ftsK can significantly impair its function, leading to defects in chromosome segregation and increased genomic instability .

  • Role in Pathogenicity: Understanding ftsK's mechanism may provide insights into the pathogenicity of Rickettsia conorii, as effective chromosome management is critical for bacterial survival and virulence .

Experimental Approaches

The investigation of ftsK typically involves several experimental techniques:

  • Transposon Mutagenesis: This method allows researchers to create random mutations within the ftsK gene to study its function in vivo.

  • PCR Amplification: Specific primers targeting ftsK are used to amplify the gene from rickettsial genomic DNA for further analysis.

  • Protein Purification: Recombinant FtsK is purified for biochemical assays to study its translocation activity and interaction with other proteins involved in DNA processing .

Future Directions

Future studies should focus on:

  • Elucidating the structural dynamics of FtsK during DNA translocation.

  • Exploring potential inhibitors that could disrupt FtsK function as a novel approach to combat rickettsial infections.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate them in your order notes, and we will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ftsK; RC1274; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-744
Protein Length
full length protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
ftsK
Target Protein Sequence
MLYYINKILSNNKVQAVILGIIGLGIVIVLTSYNIDDPSFNSVTTEYHSNLVGIFGSYLS DCLYQFFGLAAFIIPLACFVWGRNCWYGRYRGSFIRMFVMLLALVSSSTLLSKIKLEFIP ANAGGAIGIIASNFFERFTNQLYLLLIFFTFIILVVLFEIKFTSLSNFIIKLGNFLIYRI QSFLHNVFSRLSSIRLFPTKNNDKINITSSYQKPVSEKVKFPEEARSVPANPIKFFSKPV SPKISQSEIAELPPISLLRDPEKHHVKGASSLELKQKAEELLTVLNDFGVKGQIININQG PVVTQYEFEPAAGTKTSRVVGLSDDIARSLSALSTRIAVIPGKNVLGIELPNKQREFFCL KELIETPEYQDKSTLLPLVLGKDLAGKPLVADLAKMPHLLVAGTTGSGKSVGINVMIVSL LYRYTPEECRFIMIDPKMLELSAYDGIPHLLTPVVTEPSKAVVALKWAVKEMENRYRMMS NIGVKNIAGYNAKILEAVKENRIIERSIQTGFDPETGKPIYETVTMKMEKLPYIVVIVDE MADLMLVAGKDIEMLIQRLAQMARAAGIHIIMATQRPSVDVITGVIKANFPSRISFKVTS KIDSRTILGEQGSEQLLGMGDMLFMGSTSKISRVHGPFVNEAEIEQITEYLKESGTPEYI SAVTEQPEEDDSGIDIGDGTSDEVLYKKAVQIVRDERKSSISYIQRSLRIGYNKAANLVE KMEKEGIVSPPNHTGKREILLPER
Uniprot No.

Target Background

Function
Essential cell division protein that coordinates cell division and chromosome segregation. The N-terminus plays a crucial role in assembling the cell division machinery. The C-terminus functions as a DNA motor that moves dsDNA in an ATP-dependent manner towards the dif recombination site, located within the replication terminus region. Translocation terminates specifically at Xer-dif sites, where FtsK interacts with the Xer recombinase, allowing activation of chromosome unlinking through recombination. FtsK orienting polar sequences (KOPS) guide the direction of DNA translocation. FtsK can remove proteins from DNA as it translocates, but translocation halts specifically at the XerCD-dif site, preventing the removal of XerC and XerD from dif.
Database Links

KEGG: rco:RC1274

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the FtsK DNA translocase in Rickettsia conorii and what is its primary function?

FtsK is an essential DNA translocase protein in R. conorii that plays a critical role in bacterial cell division and chromosome segregation. Similar to its homologs in other bacteria such as E. coli, the FtsK protein in R. conorii functions as a DNA pump that translocates double-stranded DNA at high speeds (approximately 5 kb/s) . This process is crucial during the final stages of bacterial cell division, ensuring proper chromosome segregation before cell septation. FtsK facilitates chromosome unlinking by activating site-specific recombination, which is essential for completing cell division and maintaining genomic integrity . As R. conorii is an obligate intracellular pathogen with limited genetic manipulation tools available, understanding the function of essential proteins like FtsK provides valuable insights into potential therapeutic targets .

Why is research on R. conorii FtsK important in the context of rickettsial diseases?

Research on R. conorii FtsK is critical because:

  • R. conorii causes boutonneuse fever (Mediterranean spotted fever), a potentially severe tick-borne disease with significant public health impact .

  • As an essential protein for cell division, FtsK represents a potential target for novel antimicrobial strategies against rickettsial infections .

  • Understanding the molecular mechanisms of rickettsial replication and division, in which FtsK plays a key role, can provide insights into pathogenesis and host-pathogen interactions .

  • The study of essential bacterial proteins like FtsK contributes to our fundamental knowledge of the biology of obligate intracellular pathogens, which are notoriously difficult to study due to their growth requirements .

  • The increasing incidence of vector-borne rickettsial diseases due to environmental changes highlights the importance of developing new approaches to control these infections .

How does R. conorii FtsK compare structurally and functionally with FtsK proteins in other bacterial species?

R. conorii FtsK shares structural and functional similarities with its homologs in other bacterial species while exhibiting some unique characteristics:

Structural similarities:

  • Like other FtsK proteins, R. conorii FtsK likely contains three main domains: an N-terminal membrane-spanning domain that anchors it to the divisome, a linker domain, and a C-terminal motor domain responsible for DNA translocation .

  • The C-terminal domain is typically subdivided into α, β (forming the motor domains) and γ (regulatory) subdomains .

Functional similarities:

  • Similar to FtsK in E. coli, R. conorii FtsK likely functions as a DNA translocase that pumps DNA during cell division .

  • The γ-subdomain likely interacts with specific DNA sequences and recombinases to facilitate chromosome segregation .

  • Studies in mycobacteria have shown that FtsK is essential for growth and division, suggesting a similar critical role in Rickettsia species .

Unique characteristics:

  • As an obligate intracellular pathogen with a reduced genome, R. conorii may have adapted its FtsK protein to function within the constraints of its intracellular lifestyle .

  • The regulatory mechanisms and interaction partners may differ from those in model organisms like E. coli, reflecting the unique physiology of Rickettsia .

  • Understanding these differences is challenging due to the limited genetic tools available for Rickettsia compared to other bacterial species .

What are the current methodologies for expressing and purifying recombinant R. conorii FtsK, and what challenges do researchers face in this process?

Current methodologies:

  • Heterologous expression systems:

    • E. coli expression systems using specialized vectors containing rickettsial codon usage adaptations to improve expression efficiency .

    • Potentially using strong rickettsial promoters (such as rpsL) to drive expression, similar to methods used for other rickettsial genes .

  • Purification approaches:

    • Affinity chromatography using histidine or other fusion tags.

    • Size exclusion chromatography for further purification.

    • Specialized buffers containing stabilizing agents may be necessary due to the potential instability of the recombinant protein.

Challenges and solutions:

  • Codon optimization:

    • Challenge: Rickettsial genes often have different codon usage preferences compared to common expression hosts like E. coli.

    • Solution: Synthetic gene construction with adapted codons, as demonstrated for the arr-2 gene in R. prowazekii .

  • Protein toxicity:

    • Challenge: Expression of membrane-associated proteins like FtsK can be toxic to host cells.

    • Solution: Use of tightly regulated inducible promoters, lower induction temperatures, or specialized E. coli strains designed for toxic protein expression.

  • Protein solubility:

    • Challenge: The N-terminal membrane domain of FtsK can cause insolubility issues.

    • Solution: Expression of truncated versions containing only the soluble C-terminal motor domain, or use of fusion partners that enhance solubility.

  • Functional verification:

    • Challenge: Confirming that the recombinant protein retains native activity.

    • Solution: Development of in vitro DNA translocation assays or complementation studies using FtsK-deficient strains.

How can transposon mutagenesis be applied to study FtsK function in R. conorii, and what modifications to existing protocols are necessary?

Application of transposon mutagenesis:

Transposon mutagenesis is a powerful tool for studying gene function in bacteria, but applying it to study FtsK in R. conorii requires specific considerations:

  • Transposome system adaptation:

    • The Epicentre EZ::TN transposome system can be adapted for R. conorii by incorporating selectable markers that function in Rickettsia .

    • The transposon should contain a strong rickettsial promoter (such as rpsL) driving expression of the selection marker .

  • Conditional knockdown approaches:

    • Since FtsK is likely essential (as in mycobacteria) , complete knockout may be lethal.

    • Inducible knockdown systems similar to those used in mycobacteria can be adapted for R. conorii to study the effects of FtsK depletion .

Necessary protocol modifications:

  • Electroporation optimization:

    • Rickettsial cells require specific electroporation conditions to achieve transformation.

    • Purification of rickettsiae from host cells and preparation of electrocompetent rickettsiae requires specialized protocols .

  • Selection markers:

    • Rifampin resistance (via the arr-2 gene) has been successfully used in R. prowazekii and could be adapted for R. conorii .

    • Multiple selection markers may be necessary for sophisticated genetic manipulations.

  • Screening approaches:

    • PCR-based screening methods to identify transposon insertion sites .

    • Rescue cloning or inverse PCR techniques to determine precise insertion locations .

  • Host cell considerations:

    • Maintenance of mutants requires continuous culture in eukaryotic host cells.

    • Limiting dilution techniques may be necessary to isolate pure clones, as demonstrated for R. prowazekii mutants .

What are the optimal conditions for assaying recombinant R. conorii FtsK DNA translocase activity in vitro?

Buffer and reaction conditions:

ComponentOptimal RangeNotes
pH7.4-8.0Physiological pH similar to host cell cytoplasm
Salt (NaCl or KCl)50-150 mMLower concentrations may favor DNA binding
Divalent cations5-10 mM Mg²⁺Essential cofactor for ATP hydrolysis
ATP2-5 mMPrimary energy source for translocase activity
DNA substrateLinear dsDNA, 5-10 kbPreferably containing KOPS-like sequences
Temperature30-37°CReflecting physiological temperature
Reducing agent1-5 mM DTTTo maintain protein stability

Assay methods:

  • DNA translocation measurements:

    • Single-molecule approaches using fluorescently labeled DNA to directly observe translocation.

    • Bulk assays measuring displacement of DNA-bound proteins during translocation.

    • Triplex displacement assays to measure translocation rates.

  • ATPase activity measurements:

    • Coupled enzyme assays to measure ATP hydrolysis rates.

    • Malachite green assays to detect inorganic phosphate release.

    • Correlation between ATPase activity and DNA translocation efficiency.

  • Protein-DNA interaction studies:

    • Electrophoretic mobility shift assays to measure DNA binding.

    • Surface plasmon resonance to determine binding kinetics.

    • DNA footprinting to identify specific DNA binding sites.

  • Controls and validations:

    • ATP-binding mutants (Walker A motif) as negative controls.

    • Comparison with well-characterized FtsK homologs from model organisms.

    • Activity measurements at different protein and DNA concentrations to establish enzyme kinetics.

How can CRISPR-Cas techniques be adapted for studying FtsK function in R. conorii?

CRISPR-Cas systems offer powerful tools for genetic manipulation but require significant adaptation for use in Rickettsia species:

Development of CRISPR-Cas delivery systems:

  • Vector construction:

    • Design specialized shuttle vectors containing:

      • Origin of replication functional in both E. coli and Rickettsia

      • Selectable marker for Rickettsia (e.g., rifampin resistance)

      • Cas9 or Cas12a gene with rickettsial codon optimization

      • Guide RNA expression cassette with rickettsial promoter

  • Delivery methods:

    • Electroporation of ribonucleoprotein complexes (pre-formed Cas9-gRNA)

    • Transformation with plasmid constructs

    • Potential development of rickettsial phage-based delivery systems

Targeting strategies:

  • Conditional knockdown:

    • CRISPR interference (CRISPRi) using catalytically inactive Cas9 (dCas9) to repress ftsK expression

    • Design of guide RNAs targeting promoter or early coding regions

    • Controlled expression of dCas9 to enable temporal regulation of knockdown

  • Domain-specific studies:

    • Precise editing to introduce point mutations in functional domains (ATP binding, DNA binding)

    • Creation of domain deletions to study domain-specific functions

    • Introduction of fluorescent protein fusions to study localization

  • Genetic complementation:

    • Introduction of wild-type or mutant ftsK alleles at ectopic locations

    • Use of inducible promoters to control expression timing

    • Rescue experiments with FtsK homologs from other species

Technical considerations:

  • Guide RNA design:

    • Analysis of R. conorii genome for unique target sites

    • Minimization of off-target effects through bioinformatic prediction

    • Testing multiple gRNAs to identify optimal targeting efficiency

  • Phenotype analysis:

    • Growth measurements in host cells

    • Microscopy to assess cell morphology and division defects

    • Chromosome segregation analysis through fluorescent labeling

  • Verification methods:

    • PCR and sequencing to confirm genetic modifications

    • Western blot and immunofluorescence to verify protein expression/depletion

    • RNA-seq to assess transcriptional effects of FtsK depletion

What approaches can be used to identify and characterize the protein-protein interactions of FtsK in the R. conorii divisome?

Identification of interaction partners:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Expression of tagged FtsK (His, FLAG, or HA) in R. conorii

    • Crosslinking to stabilize transient interactions

    • Affinity purification under native conditions

    • LC-MS/MS analysis to identify co-purifying proteins

  • Bacterial two-hybrid systems:

    • Adaptation of bacterial two-hybrid systems for R. conorii proteins

    • Screening of FtsK against a library of R. conorii divisome components

    • Verification of positive interactions through targeted assays

  • Proximity-based labeling:

    • Fusion of FtsK to enzymes like BioID or APEX2

    • Biotinylation of proteins in proximity to FtsK in living cells

    • Purification and identification of biotinylated proteins

Characterization of interactions:

  • Co-immunoprecipitation studies:

    • Development of antibodies against R. conorii FtsK or use of epitope tags

    • Precipitation of FtsK complexes from R. conorii lysates

    • Western blotting to detect specific interaction partners

  • Fluorescence microscopy:

    • Immunofluorescence to co-localize FtsK with other divisome proteins

    • Development of fluorescent protein fusions if expression is feasible

    • Super-resolution microscopy to precisely map protein positions

  • Protein-fragment complementation assays:

    • Split fluorescent protein approaches to visualize interactions in vivo

    • Adaptation of split enzyme reporters for R. conorii

Mapping interaction domains:

  • Truncation analysis:

    • Creation of domain-specific constructs of FtsK

    • Identification of minimum interaction domains

    • Assessment of the impact of domain deletion on protein function

  • Site-directed mutagenesis:

    • Targeted mutation of conserved residues at putative interaction interfaces

    • Functional assays to correlate mutations with phenotypic effects

    • Structural prediction to guide mutant design

  • Peptide arrays:

    • Synthesis of overlapping peptides spanning FtsK sequence

    • Screening for binding to putative interaction partners

    • Identification of specific binding motifs

How can researchers distinguish between direct and indirect effects when studying FtsK function in R. conorii?

Distinguishing direct from indirect effects is particularly challenging when studying essential proteins like FtsK in obligate intracellular bacteria. The following approaches can help address this challenge:

Experimental strategies:

  • Temporal analysis:

    • Use of inducible expression/depletion systems to track the sequence of phenotypic changes

    • Early effects are more likely to be direct consequences of FtsK function

    • Time-course studies combining transcriptomics, proteomics, and microscopy

  • Separation of domains:

    • Expression of individual FtsK domains to dissect domain-specific functions

    • Complementation studies with chimeric proteins containing domains from different species

    • Correlation between domain-specific mutations and phenotypic effects

  • Control experiments:

    • Parallel analysis of other divisome components to identify shared vs. specific effects

    • Use of ATP-binding mutants that retain structural functions but lack motor activity

    • Comparison with depletion of other essential proteins to identify FtsK-specific phenotypes

Analytical approaches:

  • Network analysis:

    • Integration of transcriptomic, proteomic, and phenotypic data

    • Pathway enrichment analysis to identify affected cellular processes

    • Construction of causal networks to distinguish primary from secondary effects

  • Correlation analysis:

    • Quantitative correlation between FtsK protein levels and phenotypic outcomes

    • Statistical methods to establish causality vs. correlation

    • Comparison across multiple experimental conditions and genetic backgrounds

  • Computational modeling:

    • Development of predictive models of divisome assembly and function

    • Simulation of the effects of FtsK perturbation on chromosome segregation

    • Testing of alternative hypotheses through model-based predictions

What are the most significant technical challenges in studying FtsK in obligate intracellular pathogens like R. conorii, and how can they be overcome?

Challenge 1: Genetic manipulation difficulties

ChallengePotential Solutions
Limited transformation efficiencyOptimize electroporation conditions; develop alternative delivery methods
Few selectable markersAdapt new markers like rifampin resistance (arr-2) ; develop counterselection systems
Essential gene status of ftsKConditional expression systems; partial depletion approaches
Growth only in eukaryotic cellsDevelop cell-free systems for specific assays; optimize host cell models

Challenge 2: Protein expression and purification

ChallengePotential Solutions
Low protein yieldsCodon optimization; use of strong promoters
Membrane protein solubilityExpression of soluble domains; use of detergents/amphipols
Protein instabilityIdentification of stabilizing conditions; fusion to stability-enhancing tags
Functional verificationDevelopment of in vitro activity assays specific for R. conorii FtsK

Challenge 3: Imaging and localization studies

ChallengePotential Solutions
Small cell sizeSuper-resolution microscopy; electron microscopy approaches
Intracellular locationDevelopment of minimally disruptive host cell permeabilization methods
AutofluorescenceCareful selection of fluorophores; spectral unmixing techniques
Low signal-to-noise ratioSignal amplification methods; deconvolution algorithms

Challenge 4: Physiological relevance

ChallengePotential Solutions
In vitro vs. in vivo activityDevelopment of cell-based assays that maintain physiological context
Host cell influencesCo-culture systems; isolation of bacteria at different infection stages
Strain variationsComparative studies across multiple R. conorii isolates
Translation to in vivo infectionsDevelopment of improved animal models for R. conorii infection

How do researchers resolve contradictory findings in FtsK function between different bacterial species when applying insights to R. conorii?

When applying insights from model organisms to understand FtsK function in R. conorii, researchers encounter contradictions that must be carefully addressed:

Sources of contradictions:

  • Evolutionary divergence:

    • Different selective pressures on obligate intracellular vs. free-living bacteria

    • Variation in genome size and organization affecting chromosome segregation requirements

    • Co-evolution with species-specific interaction partners

  • Methodological differences:

    • Variation in experimental conditions across studies

    • Different genetic backgrounds used for mutant analysis

    • Technical limitations specific to each bacterial system

  • Functional compensation:

    • Presence of redundant or overlapping systems in some species but not others

    • Different essentiality of FtsK domains across species

    • Variation in regulatory networks controlling divisome assembly

Resolution strategies:

  • Direct comparative studies:

    • Parallel analysis of FtsK from multiple species under identical conditions

    • Heterologous complementation experiments to test functional conservation

    • Chimeric protein studies exchanging domains between species

  • Mechanistic focus:

    • Emphasis on conserved biochemical mechanisms over species-specific phenotypes

    • Identification of core FtsK functions present across diverse bacteria

    • Molecular dissection of specific activities (DNA binding, translocation, protein interactions)

  • Evolutionary context:

    • Phylogenetic analysis to place R. conorii FtsK in evolutionary context

    • Correlation of functional differences with evolutionary distance

    • Identification of lineage-specific adaptations in FtsK structure and function

  • Integrated data analysis:

    • Weighting evidence based on experimental robustness and relevance

    • Meta-analysis of published data across multiple species

    • Development of models that can accommodate species-specific variations within a common framework

What novel techniques could advance our understanding of R. conorii FtsK function in the context of host-pathogen interactions?

Advanced imaging approaches:

  • Live-cell imaging of infection:

    • Development of fluorescent R. conorii strains expressing tagged FtsK

    • Real-time visualization of division events during intracellular growth

    • Correlation of FtsK dynamics with host cell responses

  • Super-resolution techniques:

    • PALM/STORM imaging to precisely locate FtsK within the divisome

    • Correlative light and electron microscopy to link protein localization with ultrastructural features

    • Expansion microscopy to overcome the small size of bacterial cells

  • Functional imaging:

    • FRET-based sensors to detect FtsK activity in living cells

    • Visualization of chromosome dynamics during FtsK-mediated translocation

    • Simultaneous imaging of multiple divisome components

Systems biology approaches:

  • Multi-omics integration:

    • Combined transcriptomic, proteomic, and metabolomic analysis of FtsK perturbation

    • Host cell response to R. conorii expressing mutant FtsK variants

    • Network analysis to identify key pathways affected by FtsK dysfunction

  • Single-cell analysis:

    • Transcriptomics of individual bacteria during different stages of infection

    • Correlation of FtsK expression levels with division status

    • Host cell heterogeneity in response to R. conorii infection

  • Mathematical modeling:

    • Agent-based models of bacterial division within host cells

    • Predictive models of chromosome segregation dynamics

    • Integration of molecular-scale and cellular-scale models

Emerging genetic techniques:

  • CRISPR interference:

    • Targeted repression of ftsK expression to create depletion phenotypes

    • Simultaneous modulation of multiple divisome components

    • Temporal control of gene expression during infection

  • Proximity labeling:

    • Identification of proteins and host factors interacting with FtsK during infection

    • Temporal mapping of interaction networks throughout the bacterial cell cycle

    • Discovery of novel FtsK functions in the host-pathogen interface

  • Synthetic biology:

    • Creation of minimal FtsK variants to identify essential functions

    • Engineering of switchable FtsK activity for controlled division

    • Development of reporter systems for FtsK-dependent processes

How might structural studies of R. conorii FtsK advance our understanding of its function and inform drug development efforts?

Structural determination approaches:

  • X-ray crystallography:

    • Crystallization of the C-terminal motor domain of R. conorii FtsK

    • Co-crystallization with DNA substrates to capture translocation states

    • Structure determination of the γ-subdomain in complex with interaction partners

  • Cryo-electron microscopy:

    • Single-particle analysis of FtsK hexamers

    • Visualization of FtsK bound to DNA in different nucleotide states

    • Structural studies of FtsK integrated into membrane environments

  • NMR spectroscopy:

    • Solution structure of isolated domains, particularly the γ-subdomain

    • Dynamics studies to capture conformational changes during ATP hydrolysis

    • Mapping of interaction surfaces with other divisome components

Functional insights from structural data:

  • Mechanistic understanding:

    • Detailed models of DNA translocation mechanism

    • Conformational changes associated with ATP binding and hydrolysis

    • Species-specific features of the DNA-binding domains

  • Domain interactions:

    • Interdomain communication within FtsK

    • Structural basis for coupling ATP hydrolysis to DNA movement

    • Organization of the hexameric assembly

  • Species-specific adaptations:

    • Structural comparison with FtsK from model organisms

    • Identification of unique features in R. conorii FtsK

    • Correlation of structural differences with functional specialization

Drug development applications:

  • Target site identification:

    • Mapping of potential druggable pockets in the FtsK structure

    • Identification of sites critical for function but distinct from human proteins

    • Virtual screening against identified binding sites

  • Structure-based drug design:

    • Fragment-based approaches targeting ATP binding or DNA interaction sites

    • Design of allosteric inhibitors affecting hexamer assembly

    • Development of peptide-based inhibitors of protein-protein interactions

  • Selectivity considerations:

    • Structural comparison across bacterial species to identify selective targeting opportunities

    • Analysis of conservation across Rickettsia species for broad-spectrum potential

    • Evaluation of potential off-target effects based on structural similarities

What implications does FtsK research in R. conorii have for understanding basic bacterial cell biology and developing novel antimicrobial strategies?

Contributions to fundamental bacterial cell biology:

  • Chromosome segregation mechanisms:

    • Insights into how obligate intracellular bacteria coordinate replication and segregation

    • Understanding of adaptations to the constrained intracellular environment

    • Comparative analysis with free-living bacteria to identify core principles

  • Divisome assembly and regulation:

    • Elucidation of the divisome composition in Rickettsia species

    • Temporal regulation of cell division in the context of host cell infection

    • Coordination between bacterial division and host cell processes

  • Evolutionary adaptations:

    • Understanding how essential processes like chromosome segregation adapt to different lifestyles

    • Identification of conserved vs. variable features across diverse bacterial phyla

    • Insights into the minimal requirements for bacterial cell division

Implications for antimicrobial development:

  • Novel target validation:

    • Confirmation of FtsK essentiality in R. conorii provides validation as a drug target

    • Characterization of domain-specific functions to guide inhibitor development

    • Identification of species-specific features that can be selectively targeted

  • Inhibitor design strategies:

    • ATP-competitive inhibitors targeting the motor domain

    • Compounds disrupting hexamer formation or DNA binding

    • Allosteric inhibitors affecting conformational changes during translocation

  • Broad-spectrum potential:

    • Assessment of conservation across pathogenic species

    • Identification of inhibitors effective against multiple bacterial pathogens

    • Potential for addressing drug resistance through targeting essential processes

Resistance considerations:

  • Resistance mechanisms:

    • Evaluation of potential routes to resistance development

    • Assessment of the genetic barrier to resistance for FtsK-targeted compounds

    • Strategies for minimizing resistance through multi-target approaches

  • Combination therapies:

    • Identification of synergistic targets that complement FtsK inhibition

    • Rational design of combination therapies targeting different aspects of cell division

    • Host-directed therapies that could complement bacterial targets

  • Clinical application prospects:

    • Challenges in translating basic research to clinical applications

    • Potential for narrow-spectrum antibiotics targeting specific pathogens

    • Consideration of delivery methods for intracellular pathogens

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.