Recombinant Rickettsia conorii Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. To request a specific tag, please inform us; we will prioritize its development.
Synonyms
lspA; RC0558; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
lspA
Target Protein Sequence
MLPLLKKLYLTFARSSRIIITLVIIDQLSKWWFIDNLRWKSGLMLKVTSFLNMVYTWNYG ISFGLMREYYQYSNAIFLITNTIIVCYLYYLMIRSKTIGSFAGYSFVIGGAVGNLIDRFF RGAVFDFIHFHYQNYSFPVFNLADCFIIIGVIILIEDYYSTKKVIEEKAKGNYDNAQIEA MAEKIRNTDKGGNDKIASLQN
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links

KEGG: rco:RC0558

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rickettsia conorii Lipoprotein signal peptidase (lspA) and what is its function?

Lipoprotein signal peptidase (lspA) encodes the Type II Signal Peptidase (SPase II) in Rickettsia conorii, the causative agent of Mediterranean spotted fever. The lspA protein is a membrane-embedded enzyme that cleaves the signal peptide from prolipoproteins after they have been modified by the addition of a diacylglyceryl moiety to a conserved cysteine residue. The full-length R. conorii lspA protein consists of 201 amino acids and contains highly conserved domains that are essential for its enzymatic activity .

The primary function of SPase II is critical for proper bacterial lipoprotein processing and localization in the bacterial membrane. Lipoproteins play important roles in bacterial physiology and pathogenesis, including nutrient acquisition, cell envelope integrity, and host-pathogen interactions. In Rickettsia species, lipoprotein processing is particularly important for intracellular growth and virulence .

How does lspA gene expression change during the Rickettsia infection cycle?

The expression of lspA in Rickettsia species follows a distinct pattern throughout the infection cycle, as demonstrated by real-time quantitative reverse transcription-PCR (qRT-PCR) studies. Research on R. typhi has shown that lspA expression varies significantly at different stages of infection:

Infection StagelspA Expression LevelBiological Significance
Pre-infectionHighMetabolically active rickettsiae prepared for host cell invasion
0-8 hours post-infectionDecreasingInitial adaptation to intracellular environment
8-48 hours post-infectionIncreasingCorrelates with bacterial replication phase
48 hours post-infectionPeak expressionMaximum bacterial load
120 hours post-infectionDecreasingHost cell lysis phase

Why is recombinant lspA important for studying Rickettsia pathogenesis?

Recombinant lspA provides a valuable tool for understanding Rickettsia pathogenesis for several reasons:

First, as a key enzyme in lipoprotein processing, lspA is critical for bacterial survival and virulence. Higher transcriptional levels of lspA at the pre-infection stage indicate that only metabolically active rickettsiae with functioning lipoprotein processing are capable of successful infection .

Second, recombinant lspA allows researchers to study the protein's function outside of the challenging context of Rickettsia, which are obligate intracellular bacteria difficult to manipulate genetically. Expression in E. coli systems enables functional studies through complementation and inhibitor assays .

Third, bioinformatic analyses have identified only 14 putative lipoproteins out of 89 predicted secretory proteins in the R. typhi genome, highlighting the specialized nature of this processing pathway and its potential importance in pathogenesis .

Fourth, as a conserved bacterial enzyme absent in mammalian cells, lspA represents a potential target for antimicrobial development or vaccine strategies against rickettsioses, which include severe diseases like Mediterranean spotted fever .

What methodologies can be used to validate the functionality of recombinant lspA?

Validating the functionality of recombinant lspA requires multiple complementary approaches:

Genetic complementation assays: Recombinant lspA can be tested for its ability to complement the growth defect of temperature-sensitive E. coli strain Y815 at non-permissive temperatures (42°C). Successful growth restoration indicates that the recombinant protein retains biological activity. Studies have shown that R. typhi lspA can significantly restore growth of E. coli Y815 at non-permissive temperatures, though at a lower efficiency (approximately fivefold lower) than E. coli lspA .

Globomycin resistance tests: Globomycin specifically inhibits SPase II activity. E. coli cells overexpressing functional lspA show increased resistance to globomycin. In controlled experiments, E. coli cells harboring empty vector (negative control) show rapidly decreased growth at globomycin concentrations above 12.5 μg/ml, while cells expressing recombinant lspA maintain growth at concentrations from 25 μg/ml to 200 μg/ml, with statistically significant differences (p < 0.05) .

Protein expression and localization verification: Western blot analysis using anti-His antibodies can confirm the expression of recombinant lspA. Membrane fractionation studies can verify proper localization to the bacterial membrane, which is essential for function .

Enzymatic activity assays: In vitro assays using synthetic peptide substrates that mimic lipoprotein signal sequences can directly measure the proteolytic activity of purified recombinant lspA, providing quantitative data on enzyme kinetics and substrate specificity.

How should researchers design experiments to investigate contradictory findings in lspA research?

When confronted with contradictory findings in lspA research, researchers should implement a systematic experimental approach:

Standardize experimental conditions:

  • Use identical bacterial strains, growth media, and culture conditions

  • Standardize protein expression and purification protocols

  • Control for variables such as temperature, pH, and ionic strength

Employ single-subject experimental designs (SSEDs):

  • Establish clear baseline measurements

  • Implement controlled interventions

  • Return to baseline conditions to verify effects

  • Replicate the experimental effect to rule out extraneous variables

Analyze experimental context thoroughly:

  • Document all experimental parameters

  • Consider species differences (R. conorii vs. R. typhi)

  • Account for strain variations within species (e.g., R. conorii subsp. conorii vs. Israeli spotted fever strain)

Implement interrupted time series designs:

  • Collect sufficient data points before and after interventions (minimum 8 time points recommended)

  • Use segmented regression approaches to analyze changes

  • Control for secular trends and regression to the mean

Investigate apparent contradictions systematically:

  • Categorize contradictions (logical contradictions, contradictions in literature, contradictions in extracted data)

  • Identify contextual factors that may explain contradictions (species, dosage, temporal context)

  • Distinguish between true contradictions and incomplete context

Research has shown that apparent contradictions often arise from differences in experimental context rather than actual biological disagreements. For example, the different functionality of R. conorii lspA compared to E. coli lspA in complementation assays (despite similar globomycin binding) suggests that optimal function depends on proper cellular context .

What are the optimal methods for investigating lspA regulation in response to environmental factors?

Investigating lspA regulation in response to environmental factors requires sophisticated experimental approaches:

Real-time qRT-PCR analysis:

  • Design gene-specific primers (as used for R. typhi lspA: primers AZ3598 and AZ3599)

  • Use appropriate reference genes (e.g., 16S rRNA) for normalization

  • Employ cycling conditions such as: 1 cycle at 50°C for 2 min; 1 cycle at 95°C for 10 min; 40 cycles at 95°C for 15 s, 56°C for 30 s, and 60°C for 30 s

Temperature variation studies:

  • Expose Rickettsia-infected cells to different temperatures (4°C, 25°C, 37°C) to mimic vector and host environments

  • Monitor lspA expression changes during temperature shifts

  • Analyze survival rates and expression patterns

Studies with R. conorii have shown that infected ticks experience different mortality rates when exposed to temperature variations, which may influence gene expression patterns. For example, R. conorii-infected engorged nymphs exposed to low (4°C) or high (37°C) temperatures for one month showed higher mortality when transferred to 25°C compared to non-infected ticks under similar conditions .

Controlled environmental variation:

  • Systematically modify one environmental factor at a time while controlling others

  • Employ experimental designs that allow for clear delineation between pre- and post-intervention periods

  • Collect sufficient time points to ensure reliable statistical analysis

Comparative analysis across strains:

  • Compare lspA expression between virulent strains (e.g., R. conorii Israeli Spotted Fever strain) and less virulent strains (e.g., R. massiliae)

  • Correlate expression patterns with pathogenicity differences

Research has shown that different Rickettsia species induce distinct host responses that may correlate with their virulence. For instance, R. conorii Israeli Spotted Fever strain induces significant levels of IL-8 and IL-6 and causes substantial endothelial cell death by 72 hours post-infection, while the less virulent R. massiliae induces MCP-1 without significant cell death .

How can recombinant lspA be used in drug development and vaccine research?

Recombinant lspA offers several strategic approaches for developing therapeutics and vaccines against rickettsial diseases:

Target-based drug screening:

  • Use purified recombinant lspA (His-tagged R. conorii lspA expressed in E. coli) for high-throughput screening

  • Screen chemical libraries for compounds that inhibit lspA enzymatic activity

  • Test globomycin derivatives and novel structural classes as potential inhibitors

Structure-based drug design:

  • Determine the three-dimensional structure of recombinant lspA through X-ray crystallography or cryo-EM

  • Identify critical residues for catalytic activity through site-directed mutagenesis

  • Design small molecules that specifically target the active site or allosteric sites

Vaccine development approaches:

  • Evaluate recombinant lspA as a subunit vaccine antigen

  • Test different formulations and adjuvants to enhance immunogenicity

  • Develop attenuated strains with modified lspA expression as live vaccine candidates

Validation in experimental models:

  • Use cell culture models with endothelial cells (primary targets of Rickettsia infection)

  • Employ animal models that recapitulate rickettsial disease

  • Monitor disease progression, bacterial load, and host immune response

The potential for lspA as a drug target is supported by several factors:

  • It is essential for bacterial lipoprotein processing and virulence

  • It has no mammalian homolog, minimizing potential toxicity

  • It is accessible to inhibitors, as demonstrated by globomycin studies

  • It is conserved across Rickettsia species, potentially allowing broad-spectrum activity

Research has shown that when studying rickettsial pathogenesis, it's crucial to consider the host cell response. R. conorii infection of human microvascular endothelial cells induces distinct proinflammatory cytokine profiles and increased endothelial permeability, which are associated with disease severity . These host-pathogen interactions should be considered when developing therapeutic strategies targeting lspA.

What are the key considerations for designing genetic complementation studies with R. conorii lspA?

Designing effective genetic complementation studies with R. conorii lspA requires careful attention to several critical factors:

Vector selection and construction:

  • Choose vectors with appropriate promoters (e.g., pTrcHisA with trc promoter)

  • Include purification tags (His₆) for protein detection and purification

  • Confirm construct sequences before proceeding with experiments

  • Consider both constitutive and inducible expression systems

Host strain considerations:

  • Use temperature-sensitive E. coli strains (e.g., E. coli Y815) for clear phenotypic readout

  • Include wild-type E. coli strains for globomycin resistance assays

  • Consider the genetic background of the host strain and potential interactions

Experimental controls:

  • Positive control: E. coli lspA expression construct (e.g., pTrcHisEClspA7)

  • Negative control: Empty vector (e.g., pTrcHisA)

  • Multiple independent transformants to account for clonal variation

Quantitative measurement methods:

  • Growth curves at permissive and non-permissive temperatures

  • Survival percentage at various globomycin concentrations

  • Western blot analysis for protein expression verification

A successful complementation system should demonstrate:

  • Restoration of growth at non-permissive temperatures

  • Increased resistance to globomycin

  • Detectable expression of the recombinant protein

  • Correct localization to the bacterial membrane

Research has shown that while R. typhi lspA can functionally complement E. coli lspA deficiency, it does so at a lower efficiency than E. coli lspA. This may be due to the low sequence identity (22%) between rickettsial and E. coli SPase II, despite conservation of functional domains . These observations highlight the importance of appropriate controls and quantitative metrics in complementation studies.

How can researchers investigate the role of lspA in Rickettsia-host cell interactions?

Investigating the role of lspA in Rickettsia-host cell interactions requires sophisticated approaches that integrate molecular, cellular, and systems biology techniques:

Cell infection models:

  • Use human microvascular endothelial cells (HMEC-1) as the primary in vitro model, as they are the main targets of Rickettsia infection

  • Employ time-course experiments to capture the dynamic nature of infection (24, 48, 72 hours post-infection)

  • Compare wild-type Rickettsia with strains having modified lspA expression

Transcriptomic analysis:

  • Perform genome-wide expression analysis of both pathogen and host genes

  • Use custom microarrays or RNA-seq to capture the transcriptional landscape

  • Validate key findings with quantitative RT-PCR

Studies of R. conorii gene expression in infected human skin biopsies (eschars) have shown that approximately 15% of the total predicted R. conorii ORFs are differentially expressed compared to bacteria grown in standard laboratory conditions. These genes include those involved in adaptation to osmotic stress, changes in cell surface proteins, and virulence factors .

Host response assessment:

  • Measure cytokine production (IL-8, IL-6, MCP-1) by ELISA or multiplex assays

  • Assess cellular damage through live-dead cell staining, annexin V staining, and lactate dehydrogenase release

  • Evaluate endothelial monolayer integrity through electrical resistance measurements

Comparative virulence studies:

  • Compare host responses to different Rickettsia species with varying virulence

  • Correlate lspA expression levels with pathogenic potential

Research has demonstrated that the highly virulent R. conorii Israeli Spotted Fever strain causes significant cell death or injury in HMEC-1 cells at 72 hours post-infection, while the less virulent R. massiliae does not. This pathogenic difference correlates with distinct cytokine profiles: R. conorii induces IL-8 and IL-6, while R. massiliae induces MCP-1 .

By employing these integrated approaches, researchers can elucidate the specific contributions of lspA to Rickettsia pathogenesis and identify potential intervention strategies for rickettsial diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.