Recombinant Rickettsia conorii NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; RC0485; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-123
Protein Length
full length protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
nuoA
Target Protein Sequence
MLQNSELLQEYLPIAIFFGIAVLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARS KFDICFYLVAILFIIFDLEIAFLVPWAISLNTIGKIGFFSMMFFLFVLIIGFIYEWKKGA LDW
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the immediate electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving energy as a proton gradient.
Database Links

KEGG: rco:RC0485

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rickettsia conorii NADH-quinone oxidoreductase subunit A (nuoA)?

Rickettsia conorii NADH-quinone oxidoreductase subunit A (nuoA) is a protein component of the NADH dehydrogenase I complex (EC 1.6.99.5) found in Rickettsia conorii, a Gram-negative obligate intracellular bacterium that causes boutonneuse fever (also known as Mediterranean spotted fever) . NuoA functions as part of the larger NADH-quinone oxidoreductase complex, which is essential for electron transport and energy metabolism in this pathogen. The protein is relatively small, with the full-length protein sequence consisting of 123 amino acids, and its amino acid sequence includes regions rich in hydrophobic residues that facilitate membrane integration .

What is the genomic context of nuoA in Rickettsia conorii?

The nuoA gene in Rickettsia conorii is designated by the ordered locus name RC0485 . It is part of the bacterial genome that has undergone substantial evolutionary reduction compared to free-living bacteria, a common characteristic of intracellular parasitic bacteria. This genomic reduction is evident across various bacterial families including Rickettsia for alpha proteobacteria, which maintains only essential genes for its obligate intracellular lifestyle . The nuoA gene is conserved across Rickettsia species, reflecting its fundamental importance in cellular respiration and energy production.

How does nuoA contribute to Rickettsia conorii metabolism?

NuoA serves as a critical component of the NADH dehydrogenase I complex, which catalyzes the transfer of electrons from NADH to quinones in the respiratory chain . This process is fundamental to energy production in Rickettsia conorii. As an obligate intracellular pathogen, R. conorii relies on efficient energy metabolism to support its growth and replication within host cells. The NADH-quinone oxidoreductase complex, including the nuoA subunit, plays a central role in this process by helping to establish the proton gradient necessary for ATP synthesis. Disruption of this function can significantly impact bacterial viability, making it a potential target for therapeutic intervention.

What expression systems are most suitable for recombinant nuoA production?

The optimal expression system for recombinant nuoA production depends on research objectives. Escherichia coli remains the most commonly used host for initial expression studies due to its well-established protocols and rapid growth. Previous successful recombinant protein expression with Rickettsia conorii antigens has been achieved using E. coli systems, as demonstrated with the 198-kDa protein that was effectively expressed in E. coli JM107 . For nuoA specifically, considerations must include:

  • Codon optimization: Adapting the nuoA sequence to E. coli codon usage can significantly improve expression yields

  • Fusion tags: Adding solubility-enhancing tags (e.g., SUMO, MBP) may improve folding of the membrane-associated nuoA protein

  • Expression conditions: Lower temperatures (16-25°C) often improve proper folding of Rickettsia proteins

  • Membrane protein expression systems: Specialized E. coli strains designed for membrane protein expression may be beneficial

For functional studies requiring post-translational modifications, eukaryotic expression systems such as insect cells (Sf9, Sf21) may be more appropriate, although they typically yield lower protein quantities .

What structural and functional analysis techniques are most informative for nuoA research?

Multiple complementary approaches should be employed for comprehensive structural and functional characterization of nuoA:

TechniqueApplication to nuoA ResearchAdvantagesLimitations
X-ray Crystallography3D structure determinationHigh resolutionCrystallization challenges for membrane proteins
Cryo-EMStructure of nuoA within the complexVisualizes native complexesLower resolution than X-ray
Site-Directed MutagenesisFunctional residue identificationDirect correlation of structure-functionLabor intensive
Protein-Protein Interaction AssaysIdentifying interactions with other subunitsMaps functional relationshipsMay detect non-physiological interactions
Enzymatic AssaysMeasuring electron transfer activityQuantitative functional dataComplex to establish with purified components

Cross-linking studies combined with mass spectrometry have proven particularly valuable for membrane proteins like nuoA to identify interaction partners within the larger NADH-quinone oxidoreductase complex .

How can researchers evaluate the involvement of nuoA in Rickettsia conorii virulence?

Evaluating nuoA's contribution to virulence requires multiple experimental approaches:

  • In vitro infection models: Comparing wild-type R. conorii with nuoA mutants (if viable) in cell culture infection systems can reveal effects on bacterial replication, host cell invasion, and cytopathic effects.

  • Animal models: Guinea pig models have been successfully used for R. conorii infection studies and vaccine development . These models could be adapted to study nuoA function through infection with attenuated or modified strains.

  • Tick infection models: Since R. conorii is naturally transmitted by Rhipicephalus sanguineus ticks, experimental tick infection models can provide insights into nuoA's role during the vector stage of the life cycle. Established methods for infecting ticks include feeding on bacteremic rabbits (71.4% efficiency) or immersion of "one leg-cut" engorged nymphs in R. conorii solution (30% efficiency) .

  • Immunological studies: Investigating the immune response to nuoA can reveal its immunogenicity and potential as a diagnostic marker or vaccine candidate, similar to studies conducted with other R. conorii antigens .

What are the critical parameters for successful purification of recombinant nuoA?

Purification of recombinant nuoA presents challenges due to its hydrophobic nature and membrane association. A successful purification strategy should include:

  • Optimization of solubilization conditions: Screen detergents (e.g., DDM, LDAO, Triton X-100) to identify optimal solubilization of nuoA from membranes without denaturation.

  • Affinity chromatography: Utilize fusion tags (His, GST, MBP) for initial capture, with consideration for tag placement (N- or C-terminal) to avoid interfering with protein folding.

  • Size exclusion chromatography: Separate properly folded protein from aggregates and remove detergent micelles.

  • Buffer optimization: Maintain protein stability with appropriate pH (typically 7.0-8.0), salt concentration (150-300 mM NaCl), and glycerol (10-20%).

  • Storage conditions: Recombinant nuoA is optimally stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, avoiding repeated freeze-thaw cycles .

Quality assessment should include SDS-PAGE, Western blot with anti-tag or specific antibodies, and functional assays to confirm the integrity of the purified protein.

How can researchers assess the functional integrity of recombinant nuoA?

Functional assessment of recombinant nuoA should evaluate both its structural integrity and its ability to participate in electron transport:

  • Circular dichroism (CD) spectroscopy: Verify proper secondary structure formation and thermal stability.

  • Reconstitution experiments: Incorporate purified nuoA into liposomes or nanodiscs to create a minimal membrane environment.

  • Electron transport assays: Measure NADH oxidation and quinone reduction rates in reconstituted systems.

  • Complex assembly evaluation: Assess the ability of recombinant nuoA to assemble with other complex I components through co-immunoprecipitation or native gel electrophoresis.

  • Antibody recognition: Verify structural integrity through recognition by antibodies raised against native nuoA epitopes .

What considerations are important when designing site-directed mutagenesis studies of nuoA?

Site-directed mutagenesis represents a powerful approach to dissect the structure-function relationships of nuoA. When designing such studies, researchers should consider:

  • Conservation analysis: Target residues conserved across Rickettsia species or the broader Rickettsiales order, which suggests functional importance.

  • Membrane topology prediction: Map the transmembrane regions to understand which residues face the membrane lipids versus the protein interior or aqueous environment.

  • Charge distribution: Examine charged residues that may be involved in proton pumping or subunit interactions.

  • Mutant selection strategy:

    • Conservative mutations (e.g., Leu→Ile) to test structural requirements

    • Non-conservative mutations (e.g., Leu→Asp) to test functional hypotheses

    • Alanine scanning of specific regions to identify essential residues

  • Expression validation: Ensure mutations don't simply disrupt protein expression or folding by verifying expression levels and membrane incorporation.

  • Functional validation: Develop appropriate assays to detect even subtle changes in nuoA function resulting from mutations .

How should researchers interpret contradictory results from different experimental approaches to studying nuoA?

When faced with contradictory results in nuoA research, implement this systematic approach:

  • Evaluate methodological differences: Different expression systems, purification methods, or assay conditions can significantly impact results. For example, the functional properties of membrane proteins like nuoA may differ dramatically depending on the lipid environment or detergent used.

  • Consider protein state: Verify whether all experiments used comparably folded and active protein preparations. Membrane proteins are particularly sensitive to their environment, and nuoA activity may be affected by its oligomeric state or association with other complex subunits.

  • Validate with orthogonal techniques: If two methods yield contradictory results, employ a third, independent approach. For example, if structural predictions and biochemical results conflict, cryo-EM or cross-linking mass spectrometry might resolve the discrepancy.

  • Examine biological context: Results from purified recombinant systems may differ from those in whole bacteria. When possible, validate findings in R. conorii or appropriate model systems .

  • Statistical rigor: Ensure sufficient replication and appropriate statistical analysis before concluding that results are genuinely contradictory rather than reflecting experimental variability.

What computational approaches can enhance nuoA functional predictions?

Computational methods offer valuable insights into nuoA function that may guide experimental design:

  • Homology modeling: Generate structural models based on related proteins with known structures, particularly other NADH-quinone oxidoreductase subunits from bacteria with solved complex I structures.

  • Molecular dynamics simulations: Predict nuoA behavior in a membrane environment and its interactions with other subunits or substrates.

  • Evolutionary analysis:

    • Identify conserved residues through multiple sequence alignment of nuoA across Rickettsia species

    • Detect co-evolving residues that may indicate functional interactions

    • Compare to homologs in other alpha proteobacteria to identify Rickettsia-specific features

  • Protein-protein interaction prediction: Computational docking with other complex I subunits can generate testable hypotheses about assembly and function.

  • Machine learning approaches: Apply to predict functional sites, post-translational modifications, or interaction interfaces based on sequence features.

How can nuoA research contribute to vaccine development against Rickettsia conorii?

While nuoA itself has not been extensively explored as a vaccine candidate, research on other Rickettsia antigens provides a framework for investigating its potential:

  • Antigen evaluation: Recombinant nuoA could be assessed for immunogenicity and protective efficacy following the approach used for the 198-kDa R. conorii protein, which demonstrated protection in guinea pig models when delivered as sonic lysates of recombinant E. coli expressing the protein .

  • Cross-protection potential: Similar to how the 198-kDa R. conorii protein provided partial protection against R. rickettsii infection, nuoA could be evaluated for cross-protection against related Rickettsia species due to conserved epitopes .

  • Epitope mapping: Identifying immunogenic epitopes within nuoA could guide the development of epitope-based vaccines that focus immune responses on protective regions.

  • Delivery system optimization: Various delivery platforms (recombinant protein, DNA vaccines, viral vectors) could be compared for their ability to generate protective immunity against nuoA epitopes.

  • Combinatorial approaches: nuoA could be tested in combination with other identified protective antigens to develop multi-component vaccines with broader protection.

What are the promising future research directions for nuoA?

Several research avenues offer significant potential for advancing our understanding of nuoA and its applications:

  • Structural biology: Determining the high-resolution structure of nuoA within the complete NADH-quinone oxidoreductase complex from R. conorii would provide unprecedented insights into its function and interactions.

  • Drug target validation: Evaluating whether nuoA inhibition affects R. conorii viability could identify it as a potential therapeutic target, similar to how high mortality was observed in R. conorii-infected ticks, suggesting potential vulnerabilities in the pathogen's metabolism .

  • Host-pathogen interactions: Investigating whether nuoA plays a role beyond energy metabolism, such as in modulating host cell responses or adaptation to the intracellular environment.

  • Diagnostic development: Exploring recombinant nuoA as a diagnostic reagent for detecting R. conorii infection, similar to approaches used with other recombinant antigens .

  • Synthetic biology applications: Engineering modified versions of nuoA with enhanced stability or altered function for biotechnological applications in bioenergy or biosensors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.