Recombinant Rickettsia conorii NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
nuoK; RC1225; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
nuoK
Target Protein Sequence
MLRILNMNEYISLNHYLILSSLVFTIGMFGLFMHRKNIINILMSIELMLLAVNINFVAFS IYMQELSGQIFSIIILTVAAAETSIGLAILLIYFRNKGSIEITDINQMWG
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's primary electron acceptor is believed to be ubiquinone. It couples the redox reaction with proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), thereby conserving the redox energy within a proton gradient.
Database Links

KEGG: rco:RC1225

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of NADH-quinone oxidoreductase subunit K (nuoK) in Rickettsia conorii?

NADH-quinone oxidoreductase subunit K (nuoK) functions as a component of the respiratory chain complex I (NADH dehydrogenase I) in Rickettsia conorii. This enzyme complex catalyzes the transfer of electrons from NADH to quinone with the EC number 1.6.99.5, as identified in its protein characterization . The protein is also alternatively known as NADH dehydrogenase I subunit K or NDH-1 subunit K, reflecting its role in the initial electron transfer process of oxidative phosphorylation. As a membrane protein with a sequence characterized by hydrophobic regions, nuoK likely contributes to the proton-pumping function of the complex, helping generate the proton gradient necessary for ATP synthesis. This role is critical for energy metabolism in Rickettsia conorii, an obligate intracellular pathogen with limited metabolic capabilities.

What storage and handling conditions are recommended for recombinant nuoK protein preparations?

For optimal stability and activity of recombinant Rickettsia conorii nuoK protein, the following storage and handling protocols are recommended:

ParameterRecommendationNotes
Storage temperature-20°C (short-term)
-80°C (long-term)
Avoid repeated freeze-thaw cycles
Buffer compositionTris-based buffer with 50% glycerolOptimized for protein stability
Working aliquotsStore at 4°CUse within one week
Thawing procedureGentle thawing at 4°CAvoid rapid temperature changes

These recommendations are based on the storage specifications provided for the recombinant protein . The high glycerol concentration (50%) serves as a cryoprotectant, preventing ice crystal formation that could denature the protein. Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of biological activity. For experiments requiring repeated access to the protein, preparing small working aliquots that can be stored at 4°C for up to one week is advised to maintain protein integrity while minimizing freeze-thaw cycles.

How does nuoK contribute to the pathogenesis of R. conorii infection?

NADH-quinone oxidoreductase subunit K contributes to R. conorii pathogenesis primarily through its role in energy metabolism, which is crucial for bacterial survival and replication within host cells. While direct evidence linking nuoK to virulence mechanisms is limited in the provided research, its function can be contextualized within the broader understanding of R. conorii pathogenesis. As an obligate intracellular pathogen causing Mediterranean spotted fever, R. conorii requires efficient energy production systems to support its complex cell entry and intracellular lifestyle .

The cell invasion process of R. conorii involves sophisticated mechanisms including actin polymerization and recruitment of the Arp2/3 complex . These energy-dependent processes rely on ATP generated through oxidative phosphorylation, where the NADH-quinone oxidoreductase complex (containing nuoK) plays a critical role. Disruption of energy metabolism through targeting components like nuoK could potentially attenuate bacterial fitness and virulence.

Furthermore, by understanding the structure and function of nuoK, researchers might identify potential targets for therapeutic intervention. Similar to how surface proteins have been explored as vaccine candidates against R. conorii , metabolic enzymes like nuoK could represent alternative targets for antimicrobial development, particularly if they possess unique features compared to their host counterparts.

What expression systems are most effective for producing functional recombinant nuoK protein?

For the successful expression of functional recombinant Rickettsia conorii nuoK protein, several expression systems can be considered, each with distinct advantages:

Expression SystemAdvantagesConsiderations for nuoK
E. coliHigh yield, rapid growth, economyMay require optimization for membrane protein expression
Insect cellsBetter for membrane proteins, PTMsHigher cost, more complex but better folding
Cell-free systemsDirectly suitable for membrane proteinsLower yield but fewer toxicity issues

E. coli-based expression has been successfully used for other rickettsial proteins, as evidenced by the expression of a 198-kDa R. conorii protein in E. coli JM107 . For nuoK, which is a membrane protein, specialized E. coli strains (C41, C43) designed for membrane protein expression might be preferable. The tag type should be carefully selected during the production process as noted in the product specifications .

The expression vector design should include appropriate fusion tags (His, GST, MBP) to aid in purification and potentially solubility. Induction conditions need careful optimization, potentially using lower temperatures (16-25°C) and reduced inducer concentrations to prevent inclusion body formation. For membrane proteins like nuoK, detergent screening is crucial for extraction and maintaining the protein in a native-like environment throughout purification and subsequent applications.

How can structural studies enhance our understanding of nuoK function?

Structural studies of Rickettsia conorii nuoK can provide crucial insights into its function, interaction partners, and potential as a therapeutic target. Several complementary approaches can be employed:

X-ray crystallography represents the gold standard for high-resolution structural determination, though it presents challenges for membrane proteins like nuoK. Success would require careful optimization of detergents during purification and crystallization screening. Cryo-electron microscopy (cryo-EM) offers an alternative approach particularly suitable for membrane proteins and protein complexes, potentially allowing visualization of nuoK within the context of the entire NADH-quinone oxidoreductase complex.

Nuclear Magnetic Resonance (NMR) spectroscopy can provide dynamics information in addition to structure, particularly valuable for smaller membrane proteins like nuoK (110 amino acids) . This technique could help identify flexible regions important for function or interaction with other subunits.

Computational approaches including homology modeling can leverage structures of homologous proteins from other species. The amino acid sequence of nuoK can be used to generate predictive models, especially useful if crystal structures of homologous proteins from E. coli or other bacteria are available. These models can guide experimental design and help interpret functional data.

The structural information gained would facilitate understanding of how nuoK contributes to proton translocation, identify residues essential for function, and potentially reveal unique features that could be exploited for selective therapeutic targeting.

What are the most effective protocols for purifying recombinant nuoK protein?

Purification of recombinant Rickettsia conorii nuoK requires specialized protocols due to its membrane protein nature. A comprehensive purification strategy would include:

  • Cell lysis and membrane isolation:

    • Mechanical disruption (sonication or French press) in a buffer containing protease inhibitors

    • Differential centrifugation to isolate membrane fractions (40,000-100,000 × g)

    • Solubilization screening with various detergents (DDM, LDAO, CHAPS) at different concentrations

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged protein

    • Detergent concentration maintained above CMC throughout purification

    • Imidazole gradient elution with stringent washing steps to remove non-specific binding

  • Additional purification steps:

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Ion exchange chromatography for further purification if necessary

  • Quality control:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Circular dichroism to verify secondary structure integrity

    • Mass spectrometry for accurate molecular weight determination

The recombinant nuoK protein specifications indicate it can be stored in a Tris-based buffer with 50% glycerol . For structural and functional studies, detergent exchange to more suitable amphiphiles or reconstitution into nanodiscs or liposomes may be necessary. Purity should exceed 90% as determined by SDS-PAGE according to product specifications .

How can the functional activity of purified nuoK be assessed in vitro?

Assessing the functional activity of purified Rickettsia conorii nuoK protein presents unique challenges as it represents just one subunit of the multi-subunit NADH-quinone oxidoreductase complex. Several complementary approaches can be employed:

  • Reconstitution studies:

    • Co-expression and co-purification with other subunits of the complex

    • Reconstitution into liposomes with other purified subunits

    • Measurement of proton translocation using pH-sensitive fluorescent dyes

  • Binding assays:

    • Isothermal titration calorimetry (ITC) to measure binding to other subunits

    • Surface plasmon resonance (SPR) to assess interaction kinetics

    • Fluorescence-based assays to monitor conformational changes upon binding

  • Structural integrity assessments:

    • Circular dichroism to confirm proper secondary structure

    • Thermal shift assays to evaluate protein stability

    • Limited proteolysis to identify stable domains and flexible regions

  • Functional complementation:

    • Expression in bacterial strains deficient in nuoK to assess functional rescue

    • Site-directed mutagenesis of conserved residues to identify functional determinants

A comprehensive assessment would combine these approaches to build a complete picture of nuoK function. Since nuoK is part of an enzyme with EC number 1.6.99.5 , specific activity assays could be developed based on this catalytic function, particularly if the protein can be reconstituted with other complex I components.

What cellular and animal models are appropriate for studying nuoK function in vivo?

Investigating nuoK function in the context of Rickettsia conorii infection requires carefully selected in vitro and in vivo models:

Model TypeSpecific ModelsApplications for nuoK Research
Cell CultureVero cellsStudy bacterial entry mechanisms
Cell CultureEndothelial cellsTarget cells in natural infection
Cell CultureMacrophagesImmune response studies
Animal ModelsGuinea pigsEstablished model for R. conorii infection
Animal ModelsMiceGenetic manipulation possibilities

Vero cells represent an established in vitro model for studying R. conorii infection as they support bacterial attachment and invasion . The cell entry process involves complex signaling pathways including Cdc42, PI 3-kinase, and protein tyrosine kinase activities . These cells could be used to study how mutations or inhibition of nuoK affect bacterial viability and infection efficiency.

For in vivo studies, guinea pigs have been successfully used as an animal model for R. conorii infection and vaccine studies . This model could be employed to assess how targeting nuoK affects bacterial virulence, tissue tropism, and disease progression. Genetic approaches such as conditional knockdowns or expression of dominant negative forms could help elucidate the specific contribution of nuoK to infection dynamics in these models.

When designing experiments, it's important to consider the obligate intracellular nature of R. conorii and the technical challenges associated with genetic manipulation of this pathogen. Complementary approaches using surrogate bacterial systems may provide additional insights into nuoK function.

How can bioinformatic tools be used to analyze nuoK conservation and predict functional domains?

Bioinformatic analysis of Rickettsia conorii nuoK provides crucial insights into its evolution, structure, and function. A comprehensive bioinformatic workflow should include:

  • Sequence conservation analysis:

    • Multiple sequence alignment of nuoK homologs across Rickettsia species

    • Identification of conserved residues potentially critical for function

    • Calculation of conservation scores and generation of conservation heatmaps

    • Tools: Clustal Omega, MUSCLE, ConSurf

  • Structural prediction:

    • Transmembrane domain prediction using the nuoK sequence (mLRILNMNEYISLNHYLILSSLVFTIGMFGLFMHRKNIINILMSIELmLLAVNINFVAFSIYMQELSGQIFSIIILTVAAAAETSIGLAILLIYFRNKGSIEITDINQMWG)

    • Secondary structure prediction to identify α-helices and β-sheets

    • Homology modeling based on structures of homologous proteins

    • Tools: TMHMM, PSIPRED, I-TASSER, AlphaFold2

  • Functional domain prediction:

    • Identification of motifs associated with NADH binding or quinone interaction

    • Prediction of residues involved in proton translocation

    • Conservation mapping onto predicted structures

    • Tools: Pfam, InterPro, SMART

  • Evolutionary analysis:

    • Phylogenetic tree construction of nuoK across bacterial species

    • Identification of selection pressures on specific residues

    • Coevolution analysis to predict interaction interfaces

    • Tools: PAML, MISTIC, EVcouplings

The combination of these approaches can generate testable hypotheses about the function of specific residues or regions within nuoK. For instance, highly conserved residues mapped onto a structural model might indicate functional sites involved in catalysis or subunit interaction. Transmembrane topology prediction is particularly important for nuoK as it helps understand how the protein is oriented within the membrane and potentially contributes to proton translocation.

What proteomics approaches can identify interaction partners of nuoK in R. conorii?

Identifying protein-protein interactions involving nuoK in Rickettsia conorii requires specialized proteomics approaches suitable for membrane proteins:

  • Affinity-based approaches:

    • Pull-down assays using tagged recombinant nuoK as bait

    • Co-immunoprecipitation with anti-nuoK antibodies

    • BioID or APEX2 proximity labeling to identify nearby proteins

    • Sample preparation: Careful detergent selection for membrane protein extraction

  • Crosslinking mass spectrometry (XL-MS):

    • Chemical crosslinking of intact R. conorii or membrane fractions

    • Digestion and enrichment of crosslinked peptides

    • High-resolution MS/MS analysis

    • Data analysis: Specialized software for crosslink identification (pLink, StavroX)

  • Complexome profiling:

    • Blue native PAGE separation of intact complexes

    • Mass spectrometry analysis of gel slices

    • Correlation profiling to identify co-migrating proteins

    • Advantage: Maintains native complex integrity

  • Computational prediction and validation:

    • Interface prediction based on structural models

    • Targeted mutagenesis of predicted interface residues

    • Functional assays to validate interaction importance

The primary interaction partners of nuoK are expected to be other subunits of the NADH-quinone oxidoreductase complex. Research on R. conorii cell entry mechanisms has demonstrated the involvement of host factors such as the Arp2/3 complex and signaling molecules like Cdc42 and PI 3-kinase . While these are unlikely to directly interact with nuoK, understanding the protein interaction network could reveal how energy metabolism interfaces with virulence mechanisms.

Data analysis should include appropriate controls, statistical validation, and filtering against common contaminants. Visualizing the resulting interaction network can provide insights into the functional context of nuoK within both the bacterial energy metabolism system and potentially the host-pathogen interface.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.