Recombinant Rickettsia conorii Phosphatidate cytidylyltransferase (cdsA)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

Recombinant R. conorii CdsA (UniProt ID: Q92I31) is a 230-amino acid protein expressed in Escherichia coli. It belongs to the CDP-diacylglycerol synthase family (EC 2.7.7.41) and is essential for synthesizing phospholipids, which are vital for bacterial membrane integrity .

PropertySpecification
SpeciesRickettsia conorii (strain ATCC VR-613 / Malish 7)
Expression SystemE. coli
TagDetermined during production (commonly His-tag or MBP fusion)
Protein Length1–230 amino acids
FormLyophilized powder or Tris/PBS-based buffer with 50% glycerol
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C; avoid freeze-thaw cycles
ReconstitutionSterile water (0.1–1.0 mg/mL) with optional glycerol for stability

Gene and Protein Features

  • Gene Name: cdsA (Locus: RC0589) .

  • Synonyms: CDP-DAG synthase, CDP-diglyceride pyrophosphorylase.

  • Catalytic Activity: Converts phosphatidic acid to CDP-diacylglycerol, a precursor for phosphatidylglycerol and cardiolipin .

  • Sequence Motifs: Includes conserved domains for cytidylyltransferase activity (e.g., MITQKGKEHLVKDKQKSNIYLRILSG...) .

Diagnostic Development

Recombinant CdsA is utilized in ELISA kits to detect anti-R. conorii antibodies, achieving high sensitivity (90–95%) and specificity (95–100%) in serological assays . Its immunogenic epitopes make it a candidate for distinguishing rickettsial infections from other febrile illnesses .

Comparative Analysis with Homologs

FeatureR. conorii CdsA Mycoplasma genitalium CdsA
Length230 amino acids305 amino acids
Expression HostE. coliE. coli
TagVariableN-terminal His-tag
Key MotifsMITQKGKEHL...MIWELFTNIL...

Future Directions

  • Vaccine Development: Though current vaccines target surface proteins like OmpA/OmpB , CdsA’s role in membrane biosynthesis could inform novel therapeutic strategies.

  • Mechanistic Studies: Further exploration of its interaction with proteases (e.g., APRc) may elucidate its contribution to rickettsial virulence .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
cdsA; RC0589; Phosphatidate cytidylyltransferase; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
cdsA
Target Protein Sequence
MITQKGKEHLVKDKQKSNIYLRILSGIVLVPLFVIAILWCKPLFYILMILVGTGMLSEWY NMTYSSIPDLLIGLIIIPIPISLLIFLSMEDTNRWLIMLYFCIMWSVDTFAMIGGKTFKG AKLAPKLSPKKTWSGLVTGVLSAGLVAVLVSFIPNFHIENYYFSNKIYLFIISCILALIA QLSDLFISYFKRKFNIKDSGHIIPGHGGVLDRFDSIILTTLILFLMKIYL
Uniprot No.

Target Background

Database Links

KEGG: rco:RC0589

Protein Families
CDS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Phosphatidate cytidylyltransferase (cdsA) and what is its function in Rickettsia conorii?

Phosphatidate cytidylyltransferase (cdsA) is a critical enzyme that catalyzes the synthesis of cytidine diphosphate-diacylglycerol (CDP-diacylglycerol) from cytidine triphosphate (CTP) and phosphatidate. The enzymatic reaction can be represented as:

CTP + phosphatidate → diphosphate + CDP-diacylglycerol

In Rickettsia conorii, cdsA plays an essential role in phospholipid metabolism, specifically in the production of membrane phosphatidylglycerol (PG) and cardiolipin (CL), which are crucial components of bacterial cell membranes. The enzyme is membrane-bound and represents a key branch point in lipid biosynthesis pathways for this intracellular pathogen .

What are the most effective methods for purifying recombinant Rickettsia conorii cdsA?

Purification of recombinant Rickettsia conorii cdsA presents unique challenges due to its transmembrane nature. Based on current research approaches, an effective purification protocol involves:

  • Expression system selection: E. coli expression systems (particularly JM107) have proven effective for expressing rickettsial proteins, including surface proteins from R. conorii .

  • Optimization of expression conditions: Utilizing inducible promoters with careful monitoring of induction temperatures (typically 18-25°C) to prevent protein aggregation.

  • Membrane protein extraction: A gentle solubilization process using detergents such as n-dodecyl-β-D-maltoside (DDM) or Triton X-100.

  • Affinity chromatography: His-tag or other affinity tags can facilitate purification, though these should be determined during the production process to maintain functionality .

  • Storage optimization: The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, with the recommendation to avoid repeated freeze-thaw cycles .

A critical consideration is maintaining the native conformation of transmembrane regions during purification to preserve enzymatic activity for subsequent assays.

How can researchers effectively generate and validate cdsA mutants in Rickettsia conorii?

Generating cdsA mutants in Rickettsia conorii requires specialized approaches due to the challenging nature of rickettsial genetics. A validated protocol includes:

  • Transposon mutagenesis: The Kim Laboratory has developed a random insertional transposon mutagenesis scheme for generating mutant libraries of R. conorii ("kkaebi" libraries) . This approach has been successfully used to identify variants with insertional lesions.

  • Chloramphenicol resistance cassette: Allelic exchange using a chloramphenicol resistance gene (cat) cassette has proven successful for generating cdsA mutants. Despite cdsA being previously described as an essential gene in E. coli, researchers have successfully generated cdsA-null mutants in related Streptococcus species, suggesting the approach can be adapted for Rickettsia .

  • Growth characterization: Mutants typically display distinctive growth phenotypes, including marked growth defects with delays in logarithmic phase growth in standard media. Colony morphology is also affected, with smaller colonies exhibiting a pitted appearance .

  • Validation by phospholipid profiling: Confirm mutations through phospholipid analysis using 2D thin-layer chromatography (TLC) and electrospray ionization mass spectrometry. Valid cdsA mutants will show a striking reduction in phosphatidylglycerol (PG) and cardiolipin (CL) levels, with a corresponding increase in phosphatidic acid (PA), the substrate for CdsA activity .

How does cdsA function affect membrane phospholipid composition and rickettsial pathogenesis?

The cdsA enzyme plays a crucial role in rickettsial membrane composition with direct implications for pathogenesis through several interconnected mechanisms:

  • Phospholipid metabolism alterations: Mutations in cdsA result in major changes to cell membrane phospholipid content. Studies in related organisms demonstrate that cdsA mutants show a complete disappearance of phosphatidylglycerol (PG), cardiolipin (CL), and anionic phospholipid microdomains from membranes, with a corresponding increase in phosphatidic acid (PA) levels .

  • Outer membrane protein assembly: Alterations in cdsA activity affect the assembly and presentation of outer membrane proteins in Rickettsia conorii. The "pso" variants (polysaccharide synthesis operon mutants) display altered levels of surface proteins, which results in defective attachment and invasion of endothelial cells .

  • LPS O-antigen synthesis impact: Research has demonstrated that the polysaccharide synthesis operon (pso) in Rickettsia, which appears to interact with cdsA pathways, is essential for lipopolysaccharide O-antigen synthesis. Mutations in this pathway abolish O-antigen production and alter the Weil-Felix serology .

  • Host immune response modulation: The cdsA-mediated membrane composition directly influences how Rickettsia interacts with host immune responses. Variants with altered pso function fail to modulate anti-Rickettsia immune responses in endothelial cells, providing significant insights into immune pathways that could be exploited for therapeutic interventions .

This complex interplay between cdsA function, membrane composition, and pathogenesis makes it a promising target for understanding rickettsial virulence mechanisms and developing novel intervention strategies.

What is the relationship between cdsA activity and host lipid metabolism during Rickettsia conorii infection?

The relationship between Rickettsia conorii cdsA activity and host lipid metabolism represents a complex host-pathogen interaction:

  • Lipid droplet modulation: Research demonstrates that R. conorii infection initiates early lipid droplet (LD) modulation in host macrophages. This process involves triglyceride-associated lipases and fatty acid β-oxidation that regulates LD alterations in a PPAR-independent manner .

  • De novo protein synthesis requirement: The modulation of host lipid droplets during infection requires active R. conorii de novo protein synthesis. Studies using chloramphenicol to inhibit bacterial protein synthesis prior to infection show a significant decrease in the average number of lipid droplets per cell compared to vehicle-treated controls .

  • Host metabolic pathway shifts: Proteomic analysis of R. conorii-infected THP-1 macrophages reveals that infection leads to a transition to an anti-inflammatory M2 phenotype characterized by shifts in energy production and other metabolic pathways, including lipid metabolic processes involved in cell homeostasis .

  • Fatty acid synthase dependency: Host fatty acid synthase (FASN), an enzyme essential for fatty acid production, is required for R. conorii infection of THP-1 macrophages, indicating the bacterium utilizes host lipid synthesis pathways .

  • PPAR pathway interactions: Unlike other intracellular bacteria-host interactions, pharmacological inhibition of PPARα had no effect on R. conorii survival, while inhibition of PPARɣ activity actually had a positive effect on R. conorii growth. Conversely, induction of a foam cell-like phenotype diminished rickettsial survival .

This complex interplay suggests that R. conorii, through cdsA and related enzymes, manipulates host lipid metabolism to establish a replicative niche within host cells.

How can recombinant cdsA be utilized in vaccine development against Rickettsia conorii infections?

Recombinant cdsA holds potential for vaccine development against Rickettsia conorii infections through several research-supported approaches:

  • Protective antigen identification: Research with recombinant surface proteins of R. conorii has demonstrated that specific antigens can elicit protective immunity. For example, a 198-kDa R. conorii protein expressed in E. coli protected guinea pigs from experimental infections with homologous R. conorii strains and partially protected against heterologous R. rickettsii species .

  • Cross-protection potential: Due to the conservation of cdsA across rickettsial species, research suggests that targeting this enzyme could generate cross-protective immunity against multiple rickettsial pathogens. This is particularly valuable given the conservation of the pso operon among rickettsial species .

  • Antibody response targeting: Bactericidal antibodies targeting specific rickettsial components, such as the O-antigen, play a critical role in immunity. Research indicates that unlike wild-type R. conorii, pso mutants cannot elicit bactericidal antibodies that bind O-antigen, suggesting that properly structured antigens are crucial for effective antibody production .

  • Immunization protocol development: Based on experimental models, effective immunization protocols would likely involve sonic lysates of recombinant E. coli expressing the target rickettsial proteins. Studies show that guinea pigs immunized with such preparations develop antibodies recognizing R. conorii when tested by microimmunofluorescence antibody assay .

  • Immune response assessment: Validation of vaccine candidates requires robust assessment of immune responses, including:

    • Antibody development measured by microimmunofluorescence

    • Western blot confirmation of specificity

    • Challenge studies with virulent strains

    • Evaluation of cross-protection against heterologous species

What role does cdsA play in the host immune response to Rickettsia conorii infection?

The cdsA enzyme influences host immune responses to Rickettsia conorii through its impact on bacterial membrane composition and subsequent interactions with host defense mechanisms:

  • Modulation of endothelial cell responses: Rickettsial membrane components, which are dependent on proper cdsA function, influence endothelial cell responses including proinflammatory cytokine profiles and endothelial permeability. These factors play crucial roles in the pathogenesis of rickettsial diseases .

  • Induction of rickettsicidal activity: Host cells employ multiple mechanisms to eliminate intracellular rickettsiae, including indoleamine 2,3-dioxygenase (IDO) and inducible nitric oxide synthase. Increased mRNA levels of these enzymes have been detected in infection sites of patients with mild-to-moderate boutonneuse fever due to R. conorii .

  • Autophagy activation: Electron microscopy studies have shown that R. conorii can be destroyed in structures resembling autophagolysosomes in mouse brain endothelial cells that have been activated by IFN-γ and TNF-α. This suggests that autophagy may contribute to rickettsial clearance, though this mechanism requires further investigation, particularly in immune cells other than endothelial cells .

  • O-antigen-specific immunity: The O-antigen, which requires proper lipid synthesis pathways dependent on cdsA function, is a key target for protective host immunity. Infected hosts develop protective immunity against R. conorii via antibodies targeting the O-antigen. Mutations in the polysaccharide synthesis operon (pso) abolish O-antigen synthesis and affect the development of protective antibodies .

What are the current technical limitations in studying recombinant Rickettsia conorii cdsA?

Researchers face several significant technical challenges when studying recombinant Rickettsia conorii cdsA:

  • Genetic manipulation difficulties: Traditional genetic analysis of Rickettsia has been challenging due to limited genetic tools. Though recent developments include transposon mutagenesis and selection schemes to facilitate the isolation of R. conorii mutants with insertional lesions, these techniques remain complex and technically demanding .

  • Protein expression challenges: As a membrane-bound enzyme, cdsA presents specific difficulties for heterologous expression and purification while maintaining proper folding and activity. Transmembrane proteins typically require specialized expression systems and purification protocols to maintain their native conformation .

  • In vivo relevance validation: Correlating in vitro findings with in vivo relevance presents significant challenges. While guinea pig models have shown promise, the translation of findings across different experimental systems requires careful validation .

  • Structural analysis limitations: Detailed structural characterization of membrane proteins like cdsA remains challenging, limiting structure-based drug design and mechanistic understanding. The predicted topological organization includes eight transmembrane helices with critical functional motifs, but comprehensive structural data remains limited .

  • Host-pathogen interaction complexity: Understanding the intricate relationship between rickettsial cdsA activity and host cell responses, particularly in the context of lipid metabolism modulation, requires sophisticated approaches that can simultaneously track bacterial and host factors during infection .

What future research directions are most promising for understanding cdsA function in rickettsial pathogenesis?

Based on current research findings, several promising directions for future investigation of cdsA function in rickettsial pathogenesis emerge:

  • Comprehensive mutagenesis studies: Expanding the "kkaebi" libraries of R. conorii to systematically identify all genes involved in the intracellular lifecycle, with special focus on the interplay between cdsA and other components of lipid metabolism pathways .

  • Comparative analysis across rickettsial species: The conservation of the pso operon among rickettsial species suggests that it may play a universal role in O-antigen synthesis, disease pathogenesis, and immunity development. Comparative studies could reveal species-specific variations and conserved mechanisms .

  • Host-pathogen metabolic interface mapping: Detailed characterization of how R. conorii modifies host cell lipid metabolism during infection, particularly focusing on:

    • Lipid droplet formation mechanisms

    • Fatty acid metabolism pathways

    • Membrane phospholipid remodeling

    • Integration with host immune signaling

  • Therapeutic target identification: Exploration of cdsA and related enzymes as potential therapeutic targets, leveraging their essential role in rickettsial membrane biogenesis. Structure-based drug design approaches could identify specific inhibitors that disrupt rickettsial phospholipid synthesis without affecting host pathways .

  • Vaccine design optimization: Development of next-generation vaccines targeting specific rickettsial membrane components, with particular focus on generating cross-protective immunity against multiple rickettsial pathogens. This approach would build on findings that bactericidal antibodies targeting the O-antigen may generate universal immunity that could be exploited for vaccine development .

  • Tick transmission studies: Investigation of how cdsA function influences rickettsial survival and transmission in tick vectors, aligning with research goals to characterize molecular mechanisms involved in tick transmission and survey tick populations impacting the prevalence of spotted fever rickettsioses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.