Recombinant Rickettsia conorii Probable ABC transporter permease protein RC0129 (RC0129)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant RC0129 (UniProt ID: Q92JD8) is a 259-amino acid permease component of a putative ABC transporter system. Produced in Escherichia coli with an N-terminal His tag, it is purified as a lyophilized powder with >90% purity (SDS-PAGE verified) . Key attributes include:

PropertySpecification
OrganismRickettsia conorii (strain ATCC VR-613 / Malish 7)
Expression HostE. coli
Molecular Weight~30 kDa (theoretical)
Sequence CoverageFull-length (1-259 aa)
Storage Conditions-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0); avoid freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for long-term storage

Mechanism of Action

ABC transporters operate via an alternating-access model, where ATP binding/hydrolysis drives conformational shifts between inward- and outward-facing states . For RC0129:

  • Likely functions as a heterodimer with other subunits (e.g., NBD partners).

  • Potential substrates include ions, metabolites, or virulence factors critical for Rickettsia survival .

Pathogenicity Studies

Rickettsia conorii causes Mediterranean spotted fever, and ABC transporters like RC0129 may contribute to:

  • Nutrient uptake in nutrient-scarce host environments .

  • Efflux of antimicrobial agents, enhancing bacterial resistance .

Biochemical Assays

Recombinant RC0129 is utilized in:

  • ELISA-based studies to investigate antibody interactions .

  • Structural analyses (e.g., crystallization trials) to resolve transporter mechanisms .

Comparative Analysis of ABC Transporter Types

Data from structural studies of ABC transporters :

Transporter TypeOrganismNucleotide StateConformationPDB IDResolution
Type I (ModABC)A. fulgidusApoInward-facing2ONK3.1 Å
Type II (BtuCD)E. coliApoOutward-facing1L7V3.2 Å

RC0129’s structural homology to Type I importers suggests a role in substrate uptake, though experimental validation is pending .

Limitations and Future Directions

  • Functional annotation: RC0129’s exact physiological substrate remains unconfirmed .

  • Interactions: No direct protein-protein interactions have been experimentally validated .

  • Therapeutic potential: Targeting ABC transporters could disrupt Rickettsia metabolism, but inhibitor design requires high-resolution structural data .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag, please specify this in your order to allow for preferential development.
Synonyms
RC0129; Probable ABC transporter permease protein RC0129
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
RC0129
Target Protein Sequence
MLFNIANSVGKRTVKFAQSVGSFSLFSFAAVSSIIRPPLYLSLIIRQLLFIGFHSLPVVA MTTFFSGAVLALQSYIGFSRFSAESSIATVVVLSLTRELGPVLAGLMVAGRVGASIAAEI ATMRVTEQIDALYTLSTDPIKYLVFPRVITAIITMPCLVLIGDIIGVMGGYLVGVYKLDF NSAAYLTSTFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVN SSILILISNYLITELFFKV
Uniprot No.

Target Background

Function
May be a component of an ABC transporter complex.
Database Links

KEGG: rco:RC0129

Protein Families
MlaE permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rickettsia conorii and what diseases does it cause?

Rickettsia conorii conorii is the causative agent of Mediterranean spotted fever, a tick-borne disease transmitted primarily by the brown dog tick (Rhipicephalus sanguineus). Despite being studied for over a century, the relationship between this pathogen and its tick vector remains incompletely understood. Currently, there are no commercially available vaccines against boutonneuse fever (Mediterranean spotted fever) or the related Rocky Mountain spotted fever caused by Rickettsia rickettsii.

What are ABC transporters and what is their significance in bacterial pathogens?

ABC transporters are a class of integral membrane proteins that function as multidrug resistance permeases. They transport hydrophobic drugs and lipids across cell membranes by coupling substrate efflux with energy derived from ATP hydrolysis. In bacterial pathogens like Rickettsia, these transporters can play critical roles in nutrient acquisition, cellular homeostasis, and potentially antimicrobial resistance. The conformational changes of these transporters during the transport cycle allow them to translocate molecules using energy from ATP hydrolysis.

How is RC0129 classified within the ABC transporter family?

RC0129 is classified as a probable ABC transporter permease protein in Rickettsia conorii. Based on general ABC transporter structure, it likely forms part of the transmembrane domain of an ABC transporter complex. ABC transporters typically consist of transmembrane domains (including permease proteins like RC0129) that form the substrate translocation pathway, and nucleotide-binding domains that bind and hydrolyze ATP to power the transport process.

What are the recommended methods for cloning and expressing recombinant Rickettsia proteins?

Based on successful approaches with other Rickettsia proteins, a recommended protocol would involve:

  • Gene identification and isolation: Identify the RC0129 gene from R. conorii genomic DNA using PCR with specific primers.

  • Cloning strategy: Clone the gene into an expression vector with an appropriate promoter (e.g., T7) and affinity tag (e.g., His-tag).

  • Expression system: Express in E. coli, as demonstrated successfully with the 198-kDa surface protein of R. conorii.

  • Expression conditions: Optimize temperature, IPTG concentration, and induction time.

  • Protein extraction: For membrane proteins like RC0129, detergent-based extraction is typically necessary.

This approach has proven effective for other Rickettsia proteins, including the 198-kDa surface protein that was successfully cloned using a 5.5-kilobase HindIII fragment from R. conorii Kenya tick typhus genomic DNA and expressed in E. coli JM107.

What purification methods are most effective for recombinant ABC transporter proteins?

Purification of recombinant ABC transporter proteins like RC0129 requires specialized approaches due to their hydrophobic nature:

  • Membrane fraction isolation: Following cell lysis, separate membrane fractions by ultracentrifugation.

  • Detergent solubilization: Solubilize membrane proteins using appropriate detergents (e.g., DDM, LDAO, or Triton X-100).

  • Affinity chromatography: Purify using affinity tags (His, GST) with optimized detergent concentrations.

  • Size exclusion chromatography: Further purify by size to remove aggregates.

  • Protein stabilization: Maintain protein stability with specific lipids or amphipols if necessary.

The hydrophobic nature of ABC transporters makes them challenging to purify in their native conformation, requiring careful optimization of detergent conditions throughout the purification process.

How can I verify the structural integrity of purified recombinant RC0129?

Multiple complementary techniques should be employed:

  • SDS-PAGE and Western blotting: Confirm protein size and immunoreactivity using antibodies against RC0129 or affinity tags.

  • Circular dichroism (CD) spectroscopy: Assess secondary structure content.

  • Fluorescence spectroscopy: Evaluate tertiary structure integrity.

  • Limited proteolysis: Examine folding by comparing digestion patterns of recombinant vs. native protein.

  • Functional assays: Test ATP binding and hydrolysis activities if the nucleotide-binding domain is present.

For Rickettsia proteins, immunoblotting has been effectively used to confirm protein identity and integrity, as demonstrated with the 198-kDa R. conorii protein when recognized by monospecific polyclonal rabbit antiserum.

What functional assays can be used to characterize the transport activity of RC0129?

Several complementary approaches can assess RC0129 transport function:

  • Reconstitution in proteoliposomes: Incorporate purified RC0129 into liposomes to measure substrate transport across the membrane.

  • ATPase activity assays: If paired with the nucleotide-binding domain, measure ATP hydrolysis in the presence of potential substrates.

  • Fluorescent substrate transport: Use fluorescent substrates to monitor real-time transport.

  • Whole-cell transport assays: Express RC0129 in a heterologous system lacking similar transporters and measure substrate accumulation or efflux.

  • Electrophysiology: For ion-transporting ABC proteins, patch-clamp techniques can measure transport activity.

These assays collectively provide insights into transport kinetics, substrate specificity, and the coupling mechanism between ATP hydrolysis and substrate translocation.

How can I identify the natural substrates of the RC0129 ABC transporter?

Identifying natural substrates requires a systematic approach:

  • Computational predictions: Use homology-based predictions to identify likely substrate classes based on sequence similarity to characterized ABC transporters.

  • Transport assays with candidate substrates: Screen various molecules including lipids, metabolites, and antimicrobial compounds.

  • Competitive inhibition studies: Test if candidate substrates inhibit transport of known substrates.

  • Differential expression analysis: Examine expression changes of RC0129 under various growth conditions to infer function.

  • In vivo phenotypic studies: Create knockout or overexpression strains to observe phenotypic changes related to specific metabolic pathways.

This multifaceted approach can overcome the challenge of identifying substrates for orphan transporters in specialized pathogens like Rickettsia.

What role might RC0129 play in Rickettsia conorii pathogenesis?

Based on understanding of bacterial ABC transporters, RC0129 might contribute to pathogenesis through:

  • Nutrient acquisition: Importing essential nutrients from the host environment.

  • Toxin export: Potentially exporting virulence factors.

  • Antimicrobial resistance: Exporting host-derived antimicrobial compounds.

  • Immune evasion: Maintaining membrane homeostasis under stress conditions.

  • Host cell interaction: Potentially modulating the host-pathogen interface.

Further research correlating RC0129 function with Rickettsia survival in tick vectors and mammalian hosts is needed to fully understand its role in pathogenesis.

How might the interaction between RC0129 and the tick vector influence Rickettsia conorii transmission?

The interaction between RC0129 and the tick vector could significantly influence pathogen transmission through several mechanisms:

What strategies can overcome challenges in expressing membrane proteins from obligate intracellular pathogens?

Expressing membrane proteins from obligate intracellular pathogens presents unique challenges that can be addressed through:

  • Codon optimization: Adjust codon usage to match the expression host.

  • Fusion partners: Use solubility-enhancing fusion partners like MBP, SUMO, or Trx.

  • Expression host selection: Test multiple expression systems beyond E. coli, including:

    • Cell-free expression systems

    • Insect cells (Sf9, High Five)

    • Mammalian expression systems

  • Truncation strategies: Express functional domains individually if the full-length protein is problematic.

  • Chaperone co-expression: Co-express molecular chaperones to assist folding.

The successful expression of the 198-kDa surface protein from R. conorii in E. coli demonstrates the feasibility of recombinant expression of Rickettsia proteins, though membrane proteins like RC0129 may require additional optimization.

How can I design experiments to investigate the potential role of RC0129 in antimicrobial resistance?

A comprehensive experimental approach would include:

  • Gene expression analysis: Measure RC0129 expression changes in response to antibiotic exposure.

  • Gene knockout or silencing: Create RC0129-deficient Rickettsia (if genetic manipulation is possible) or use antisense RNA approaches.

  • Heterologous expression: Express RC0129 in a model bacterium to test if it confers resistance.

  • Transport assays: Test if RC0129 can transport antibiotics using reconstituted proteoliposomes.

  • Structural studies: Perform in silico docking of antibiotics to predict interactions.

Experimental ApproachAdvantagesLimitationsKey Controls
Gene expression analysisNon-invasive; applicable to field isolatesCorrelative rather than causativeHousekeeping gene normalization
Gene knockoutDirect causative evidenceTechnically challenging in RickettsiaComplementation studies
Heterologous expressionEasier technical implementationMay lack necessary cofactorsEmpty vector controls
Transport assaysDirect functional evidenceRequires purified proteinATPase-deficient mutants
Structural studiesInsights into mechanismRequires validationExperimental confirmation

What bioinformatic tools can predict the structure and function of RC0129?

Several specialized tools can provide insights into RC0129 structure and function:

  • Sequence analysis tools:

    • BLAST and PSI-BLAST for homology identification

    • HMMER for sensitive domain detection

    • TMHMM and TOPCONS for transmembrane topology prediction

  • Structural prediction tools:

    • AlphaFold2 for 3D structure prediction

    • SWISS-MODEL for homology modeling

    • Molecular dynamics simulations for conformational analysis

  • Functional prediction tools:

    • TransportDB for transporter classification

    • COACH for ligand binding site prediction

    • ConSurf for evolutionary conservation analysis

  • Genomic context analysis:

    • STRING for protein-protein interaction networks

    • SyntTax for synteny analysis

These tools collectively can provide a comprehensive computational characterization of RC0129 when experimental data is limited.

What expression systems are most suitable for functional studies of RC0129?

Different expression systems offer distinct advantages for RC0129 functional studies:

  • E. coli-based systems:

    • C41/C43(DE3) strains: Engineered for membrane protein expression

    • Lemo21(DE3): Tuneable expression to prevent toxicity

    • Advantages: High yield, simple handling

    • Limitations: May not provide optimal folding for Rickettsia proteins

  • Yeast systems:

    • Pichia pastoris: Suitable for functional expression of eukaryotic-like transporters

    • Saccharomyces cerevisiae: Genetic tractability for functional complementation

    • Advantages: Eukaryotic processing, suitable for functional studies

    • Limitations: Lower yields than bacterial systems

  • Insect cell systems:

    • Sf9/Sf21 or High Five cells with baculovirus vectors

    • Advantages: Good yields, eukaryotic processing

    • Limitations: More complex handling, higher cost

  • Cell-free systems:

    • Advantages: Rapid, adaptable for membrane proteins with nanodiscs/liposomes

    • Limitations: Lower yields, requires optimization

The choice should be guided by the specific experimental goals, with E. coli systems already proven successful for some Rickettsia proteins.

How can I develop antibodies against RC0129 for localization and functional studies?

A systematic approach to antibody development includes:

  • Antigen design strategies:

    • Full-length recombinant protein (challenging for membrane proteins)

    • Extracellular/periplasmic domains (more accessible, potentially conformational)

    • Synthetic peptides from predicted antigenic regions

    • Fusion proteins with carrier proteins

  • Antibody production options:

    • Polyclonal antibodies: Faster, recognize multiple epitopes

    • Monoclonal antibodies: Higher specificity, renewable resource

    • Recombinant antibodies: Customizable, animal-free

  • Validation methods:

    • Western blotting against recombinant protein and native Rickettsia lysates

    • Immunofluorescence on infected cells

    • Pre-adsorption controls with recombinant protein

    • Testing on RC0129-deficient strains (if available)

Previous work with Rickettsia proteins demonstrates the effectiveness of polyclonal antisera prepared against specific proteins for identification and characterization, as shown with the 198-kDa protein from R. conorii.

How should I design experiments to study the effect of temperature on RC0129 function in the tick-Rickettsia interface?

When investigating temperature effects on RC0129 function, consider this experimental design framework:

  • Statement of Problem: Determine how temperature affects RC0129 expression and function in R. conorii within tick vectors.

  • Hypothesis: Temperature fluctuations alter RC0129 expression and transport activity, affecting R. conorii survival in ticks.

  • Variables:

    • Independent Variable: Temperature (levels: 4°C, 25°C, 37°C)

    • Dependent Variables: RC0129 expression levels, transport activity, bacterial viability

    • Controlled Variables: Tick species/strain, infection level, humidity, feeding status

  • Experimental Control: Uninfected ticks maintained at each temperature and R. conorii infected ticks with a different transporter knockout.

  • Procedure:

    • Establish infected and non-infected tick colonies at controlled temperatures

    • Harvest ticks at regular intervals

    • Quantify RC0129 expression using qRT-PCR

    • Measure RC0129 activity using isolated membrane vesicles

    • Assess bacterial viability and replication rates

This experimental design follows standard scientific methodology, addressing the significant finding that temperature strongly affects survival of R. conorii-infected ticks.

What experimental approaches can determine if RC0129 contributes to Rickettsia survival in different hosts?

A comprehensive investigation would include:

  • Comparative expression analysis:

    • Measure RC0129 expression levels in:

      • Rickettsia grown in tick cells vs. mammalian cells

      • Rickettsia during different life cycle stages

      • Field isolates with different virulence profiles

  • Functional inhibition studies:

    • Develop specific inhibitors of RC0129 transport function

    • Assess effects on Rickettsia survival in different host cells

  • Genetic approaches (if feasible):

    • Create RC0129 knockout or knockdown strains

    • Assess colonization efficiency in tick vs. mammalian models

    • Perform complementation studies with wild-type RC0129

  • Host response interaction:

    • Determine if RC0129 activity affects host immune response

    • Investigate if RC0129 transports host-derived defense molecules

These approaches would help elucidate the role of RC0129 in the dramatic differences observed in R. conorii survival under various environmental conditions.

How can I evaluate potential cross-protection between R. conorii and R. rickettsii based on ABC transporter homology?

To evaluate cross-protection potential:

  • Sequence and structural analysis:

    • Perform detailed sequence alignment of RC0129 with R. rickettsii homologs

    • Identify conserved epitopes across species

    • Model 3D structures to compare functional domains

  • Immunological cross-reactivity testing:

    • Generate antibodies against RC0129

    • Test cross-reactivity with R. rickettsii proteins

    • Evaluate antibody inhibition of transport function

  • Animal model studies:

    • Immunize animals with recombinant RC0129

    • Challenge with both R. conorii and R. rickettsii

    • Assess protection levels against both species

  • T-cell epitope analysis:

    • Identify potential T-cell epitopes in RC0129

    • Test epitope recognition by T-cells from immunized animals

    • Evaluate epitope conservation across Rickettsia species

This approach builds on previous findings that guinea pigs immunized with recombinant E. coli expressing R. conorii protein were protected from homologous R. conorii infection and partially protected from heterologous R. rickettsii infection.

What are the most promising applications of RC0129 research for vaccine development?

RC0129 research could contribute to vaccine development through several avenues:

  • Subunit vaccine potential: If RC0129 is exposed on the bacterial surface or secreted, it could serve as an antigen in subunit vaccines. Previous work with a 198-kDa R. conorii surface protein demonstrated protection in guinea pigs from experimental infections with both homologous R. conorii and heterologous R. rickettsii, suggesting cross-protection potential.

  • Attenuated vaccine design: Understanding RC0129's role in pathogen fitness could inform rational attenuation strategies. The observed effects of temperature on R. conorii survival in infected ticks suggest that modifications to temperature-sensitive pathways could produce attenuated strains suitable for vaccine development.

  • Adjuvant delivery systems: ABC transporters can be engineered as delivery systems for vaccine adjuvants, potentially enhancing immunogenicity.

  • Broad-spectrum protection: Identifying conserved functional domains in ABC transporters across Rickettsia species could lead to vaccines providing protection against multiple rickettsial diseases.

  • Vector-based transmission blocking: If RC0129 is essential for survival in the tick vector, targeting it could lead to transmission-blocking vaccines that prevent tick-to-human transmission.

How might systems biology approaches enhance our understanding of RC0129 in Rickettsia pathogenesis?

Systems biology offers powerful frameworks to contextualize RC0129 function:

These approaches could reveal how RC0129 fits into the complex relationship between R. conorii and its tick host, potentially explaining the observed low prevalence of infected ticks despite efficient transovarial transmission.

What are the key methodological challenges in studying the conformational dynamics of RC0129 during transport?

Studying conformational dynamics of membrane transporters presents specific challenges:

  • Technical limitations:

    • Crystallization difficulties for membrane proteins

    • Size limitations for solution NMR

    • Sample preparation challenges for cryo-EM

    • Temporal resolution for capturing transport intermediates

  • Proposed methodological solutions:

    • Single-molecule FRET to track real-time conformational changes

    • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

    • Crosslinking mass spectrometry to capture transport states

    • Molecular dynamics simulations to model the transport cycle

    • EPR spectroscopy with site-directed spin labeling

  • Special considerations for Rickettsia proteins:

    • Limited availability of genetic tools for native labeling

    • Challenges in obtaining sufficient material from obligate intracellular pathogens

    • Potentially unique lipid requirements for functional reconstitution

Understanding conformational changes is critical for elucidating the coupling mechanism between ATP hydrolysis and substrate translocation in ABC transporters like RC0129.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.