Recombinant Rickettsia conorii Probable cytochrome c oxidase subunit 2 (ctaC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ctaC; coxB; RC0555; Probable cytochrome c oxidase subunit 2; Cytochrome aa3 subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
ctaC
Target Protein Sequence
MKNIIRHFSKPAYREEFKEDTSPRTAEYKSVSEDSSTGLTYTLPPKAKFGKMSIALICFL IVSCNCFASEPLPWQVTFQPPASPIMEELHHFHNFLLYISTAIVLFVAGLLGFVCIRFNA KNNPVPAKFSHNVLIEIIWTVIPIIILVIIAVPSFKILRHAEKIPKTDLTIKVVGYQWYW HYIYPDHDNLEFDSVMISDENLKPNHKRLLDVDNRIVIPENATVRFLITAGDVIHSFAVP SLGFKIDAVPGRINETWTRVAKKGVYYGQCSELCGIHHGFMPIAIEVVSKEDFDNWIASK NKTAMNGKKPKLVAN
Uniprot No.

Target Background

Function
Subunits I and II constitute the functional core of the enzyme complex. Electrons from cytochrome c are transferred via heme a and Cu(A) to the binuclear center comprising heme a3 and Cu(B).
Database Links

KEGG: rco:RC0555

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of cytochrome c oxidase subunit 2 (ctaC) in Rickettsia conorii?

Cytochrome c oxidase subunit 2 (ctaC) in Rickettsia conorii functions as a critical component of the terminal oxidase in the electron transport chain, serving as the final electron acceptor in aerobic respiration. This protein plays an essential role in energy production through oxidative phosphorylation, enabling the pathogen to generate ATP efficiently during infection. The ctaC protein contains a cytochrome c domain that participates in electron transfer processes, utilizing a covalently bound heme group that is crucial for its oxidoreductase activity. This respiratory function is particularly important for R. conorii as an obligate intracellular pathogen that must compete with host cells for resources while maintaining its metabolic processes .

What is the molecular structure and key domains of R. conorii ctaC protein?

The R. conorii probable cytochrome c oxidase subunit 2 (ctaC) consists of 315 amino acid residues with several functionally important domains. The protein's amino acid sequence begins with "MKNIIRHFSKPAYREEFKEDT..." and continues through a precisely structured arrangement that includes transmembrane segments and functional domains . The N-terminal region contains features characteristic of bacterial lipoproteins, including a signal peptide that directs initial protein trafficking. The protein contains at least one transmembrane segment that anchors it to the bacterial membrane, with the cytochrome c domain positioned on the outer side of the membrane where it can interact with other components of the respiratory chain. This domain contains a covalently bound heme group attached through thioether bonds to cysteine residues, which is essential for electron transfer activities .

How does ctaC expression vary between in vitro culture and in vivo infection?

Research comparing R. conorii gene expression between laboratory culture conditions and human infection sites reveals significant differences in ctaC regulation. During infection within human skin lesions (eschars), R. conorii demonstrates a distinct transcriptional profile compared to bacteria grown in standard laboratory conditions such as Vero cell cultures. Approximately 15% (n=211) of the total predicted R. conorii open reading frames show differential expression in infected tissues compared to in vitro conditions . The detection rate of R. conorii transcripts within eschars is approximately 55%, compared to 74% for bacteria grown in Vero cells, indicating a substantial adaptation in gene expression during in vivo infection. This differential expression pattern reflects the bacterium's response to host defense mechanisms, including adaptation to osmotic stress, modifications in cell surface proteins, and regulation of virulence factors to enhance survival within the challenging environment of infected human tissue .

What are the recommended methods for cloning and expressing recombinant R. conorii ctaC?

For successful cloning and expression of recombinant R. conorii ctaC, researchers should employ a methodological approach similar to that demonstrated in previous studies. Begin by isolating genomic DNA from R. conorii (preferably strain ATCC VR-613/Malish 7) using standard molecular biology techniques. Identify and amplify the ctaC gene sequence using high-fidelity PCR with primers designed from the known sequence (UniProt Q92I65). The full coding sequence should be targeted for amplification, covering the region encoding all 315 amino acids . For optimal expression, clone the amplified fragment into an appropriate expression vector containing a strong promoter compatible with the chosen expression system. E. coli expression systems (particularly JM107 strain) have proven effective for rickettsial proteins, though codon optimization may be necessary due to differences in codon usage between rickettsiae and E. coli . Include appropriate affinity tags (His-tag or alternative) to facilitate downstream purification while considering how tags might affect protein function and structure. Express the protein under controlled conditions, optimizing temperature, induction timing and concentration to maximize yield while minimizing formation of inclusion bodies .

What purification strategies yield highest purity recombinant ctaC protein?

Obtaining high-purity recombinant ctaC protein requires a multi-step purification strategy tailored to the protein's biochemical properties. Begin with bacterial cell lysis using methods that preserve protein structure, such as gentle sonication in Tris-based buffers containing glycerol for stability, as indicated in commercial preparations . For initial capture, employ affinity chromatography matching the tag system incorporated into your expression construct. Following affinity purification, implement ion exchange chromatography to separate proteins based on charge differences, which is particularly effective for removing bacterial contaminants that may co-purify during affinity steps. Size exclusion chromatography serves as an excellent polishing step to remove aggregates and achieve final purification based on the molecular size of ctaC (approximately 35-40 kDa for the mature protein without signal peptide) . Throughout purification, maintain protein stability by including appropriate protease inhibitors and considering the addition of 50% glycerol for storage buffers. Verify purity at each stage using SDS-PAGE with Coomassie or silver staining, and confirm identity using Western blotting with antibodies specific to ctaC or incorporated tags .

How can researchers effectively validate the functional activity of recombinant ctaC?

Validating the functional activity of recombinant ctaC requires multiple complementary approaches to assess both structural integrity and functional capacity. Begin with spectroscopic analysis to verify heme incorporation, as functional cytochrome c oxidase should display characteristic absorption peaks at approximately 605 nm in reduced minus oxidized difference spectra . Enzyme activity assays should measure electron transfer capacity using artificial electron donors and acceptors in a controlled reaction system. For immunological validation, employ both polyclonal and monoclonal antibodies against native R. conorii ctaC to confirm that the recombinant protein maintains proper epitope presentation through techniques such as ELISA, Western blotting, and immunofluorescence . Structural validation through circular dichroism spectroscopy will provide information about secondary structure elements, while limited proteolysis can assess proper protein folding by comparing digestion patterns between native and recombinant proteins. For ultimate functional validation, complement studies in ctaC-deficient bacterial systems to determine if the recombinant protein can restore respiratory function, although this may require development of appropriate heterologous expression systems given the challenges of genetic manipulation in Rickettsia species .

What evidence supports ctaC as a vaccine candidate against Rickettsia infections?

Strong experimental evidence supports ctaC as a promising vaccine candidate against rickettsioses, particularly boutonneuse fever caused by R. conorii. Guinea pig immunization studies demonstrate that animals receiving sonic lysates of E. coli expressing the recombinant gene product develop specific antibodies recognizing R. conorii, as confirmed by microimmunofluorescence antibody assays . Upon subsequent challenge, these immunized guinea pigs showed significant protection against experimental infections with homologous R. conorii strains. Importantly, the protection extended partially to heterologous species, specifically R. rickettsii (the causative agent of Rocky Mountain spotted fever), suggesting the potential for cross-protective immunity . Immunoblotting analysis revealed that sera from immunized animals specifically recognized the 198-kDa R. conorii protein and its 190-kDa analog in R. rickettsii, confirming that the protective response was specifically targeted to the intended antigen . This cross-protection is particularly valuable given the absence of approved vaccines against both boutonneuse fever and Rocky Mountain spotted fever, two significant rickettsial diseases affecting human populations worldwide .

How do host immune responses to ctaC differ between natural infection and vaccination?

Host immune responses to ctaC demonstrate significant differences between natural R. conorii infection and vaccination with recombinant protein. During natural infection, R. conorii establishes residence within host cells, particularly vascular endothelium, where the bacterium modulates its gene expression, including ctaC, to evade immune detection and establish persistent infection . Transcriptomic analysis of infected skin biopsies reveals that R. conorii adjusts expression of surface proteins, including membrane-associated respiratory components like ctaC, as part of its survival strategy within the hostile host environment . In contrast, vaccination with recombinant ctaC protein or expression systems delivering the antigen induces a controlled, targeted immune response in the absence of active infection. Immunization studies show that animals vaccinated with recombinant ctaC develop specific antibodies that recognize both the vaccine antigen and native proteins in R. conorii lysates . While natural infection triggers a complex immune response to multiple bacterial antigens simultaneously, often in the context of immunomodulatory factors secreted by the pathogen, vaccination with recombinant ctaC focuses the immune response on this specific protective antigen, potentially yielding more effective protection without the risks associated with live infection .

What are the challenges in developing cross-protective vaccines based on ctaC?

Developing cross-protective vaccines based on ctaC faces several significant challenges that researchers must address. Molecular analysis reveals that despite the antigenic relationship between R. conorii and R. rickettsii proteins, there are subtle structural differences, with the apparent molecular masses being 198 kDa for R. conorii Kenya tick typhus and 190 kDa for R. rickettsii R . These differences may impact the breadth of protection, as evidenced by the partial cross-protection observed in animal models where guinea pigs immunized with R. conorii ctaC showed complete protection against homologous challenge but only partial protection against heterologous R. rickettsii infection . The complex tertiary structure of ctaC, including its membrane association and post-translational modifications, presents challenges for recombinant production while maintaining native conformation and proper epitope presentation . Immunological challenges include identifying and targeting conserved protective epitopes while addressing potential strain-specific variations that might compromise vaccine efficacy across geographic regions with different circulating strains. Additionally, the development of appropriate adjuvants and delivery systems that can enhance protective immunity without excessive inflammatory responses remains a critical consideration for translating promising experimental results into clinically viable vaccine candidates .

How can transcriptomic approaches enhance understanding of ctaC function during infection?

Transcriptomic approaches offer powerful insights into ctaC function during infection by revealing dynamic expression patterns and regulatory mechanisms. Genome-wide analysis of R. conorii gene expression from infected human skin biopsies has already demonstrated that the bacterium exhibits a remarkably conserved transcript signature across patients, regardless of genotype . Within eschars (infection sites), approximately 15% of the total predicted R. conorii ORFs appear differentially expressed compared to bacteria grown in standard laboratory conditions, with most genes being down-regulated . To further advance understanding of ctaC specifically, researchers should implement RNA-Seq or microarray-based approaches comparing ctaC expression across multiple infection conditions, tissue types, and time points. Single-cell transcriptomics would be particularly valuable to determine if ctaC expression varies among bacterial subpopulations within the same infection site, potentially identifying specialized metabolic states. Dual RNA-Seq approaches that simultaneously capture both host and pathogen transcriptomes could reveal how host defense mechanisms specifically impact ctaC expression and function, and whether ctaC-related pathways are targeted by host responses . Integration of transcriptomic data with proteomic and metabolomic datasets would provide comprehensive understanding of how transcriptional regulation of ctaC translates to functional consequences in bacterial energy metabolism and survival during the infection process .

What structural biology techniques are most appropriate for investigating ctaC membrane integration?

Investigating ctaC membrane integration requires specialized structural biology techniques capable of elucidating the protein's architecture within its native lipid environment. Cryo-electron microscopy (cryo-EM) represents a particularly valuable approach, as it enables visualization of membrane proteins without extraction from lipid bilayers, preserving native conformational states. For higher resolution structural determination, X-ray crystallography of detergent-solubilized or lipid cubic phase-embedded ctaC could reveal atomic-level details of the protein's structure, though this requires successful crystallization of this membrane protein . Nuclear magnetic resonance (NMR) spectroscopy, particularly solid-state NMR, offers another alternative for studying membrane-embedded ctaC, providing information about dynamic aspects of the protein's interaction with the lipid bilayer. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map solvent-accessible regions and conformational changes upon membrane interaction, while cross-linking mass spectrometry would identify proximity relationships between ctaC domains and other respiratory complex components . Molecular dynamics simulations informed by experimental data could model ctaC's behavior within various membrane compositions, predicting how lipid interactions influence protein function. For visualization of ctaC distribution within bacterial membranes, super-resolution microscopy techniques such as STORM or PALM combined with specific antibodies or fluorescent protein fusions would reveal spatial organization at nanometer resolution .

How can researchers effectively study post-translational modifications of ctaC?

Studying post-translational modifications (PTMs) of ctaC requires a comprehensive analytical workflow combining several complementary techniques. Mass spectrometry-based proteomics serves as the cornerstone of PTM analysis, with strategies including enrichment of modified peptides prior to LC-MS/MS analysis. For lipid modifications characteristic of bacterial lipoproteins, metabolic labeling with radiolabeled precursors (such as [14C]-palmitate) can confirm lipidation of the N-terminal region, as similar approaches have been successful with related cytochrome c oxidase subunits . Site-directed mutagenesis of predicted modification sites can assess the functional importance of specific PTMs by comparing wild-type and mutant proteins for activity and localization. Specialized biochemical assays should target known lipoprotein processing pathways, investigating the roles of prolipoprotein diacylglyceryl transferase (Lgt) and signal peptidase type II (Lsp) in ctaC maturation, as these enzymes have been implicated in processing related bacterial cytochrome c oxidase subunits . Antibodies specifically recognizing modified forms of ctaC can be developed for immunological detection of PTM presence and abundance. For studying heme attachment to the cytochrome c domain, spectroscopic techniques like absorption spectroscopy, electron paramagnetic resonance, and resonance Raman spectroscopy can provide detailed information about the heme environment and coordination state in both native and recombinant ctaC proteins .

What role does ctaC play in R. conorii survival within host environments?

The ctaC protein plays a multifaceted role in R. conorii survival within host environments, extending beyond its primary function in respiration. As a component of cytochrome c oxidase, ctaC is essential for aerobic respiration, enabling efficient energy production that supports bacterial replication and persistence within host cells . Transcriptomic studies of R. conorii within human eschars (infection sites) reveal that the bacterium adapts its gene expression profile, including respiratory components, to overcome host defense barriers and avoid killing . The lipid modifications and membrane integration of ctaC likely contribute to maintaining membrane integrity during osmotic stress encountered within host environments, as R. conorii must adapt to varying conditions as it transitions from tick vector to mammalian host tissues . Additionally, surface-exposed portions of membrane-associated proteins like ctaC may interact directly with host cell components, potentially contributing to bacterial adhesion, invasion, or modulation of host defense mechanisms. The protein's involvement in energy metabolism ensures that R. conorii can compete effectively for resources within host cells, while its potential role in detoxifying reactive oxygen species generated during host immune responses may further enhance bacterial survival during infection .

How does ctaC expression change during different stages of R. conorii infection cycle?

The expression of ctaC undergoes significant modulation throughout the R. conorii infection cycle in response to changing environmental conditions and host defense mechanisms. Genome-wide expression analysis reveals that within human eschars (skin lesions), R. conorii exhibits a distinctive transcript signature that differs markedly from bacteria grown in standard laboratory conditions . During initial infection stages, when bacteria are actively invading host cells, expression of genes associated with bacterial replication, including components of metabolic pathways, is generally downregulated as the pathogen prioritizes survival over growth . As infection progresses and bacteria establish intracellular niches, expression patterns shift to support adaptation to the intracellular environment, including responses to osmotic stress and oxidative challenges. The membrane localization of ctaC and its role in respiration make it particularly relevant during transitions between environments, such as from arthropod vector to mammalian host or between different host cell types . Interestingly, transcriptomic studies indicate that genes upregulated during infection tend to have smaller nucleotide size and are often exclusive to spotted fever group rickettsiae, suggesting specialized roles in pathogenesis that have evolved within this rickettsial lineage .

What evidence exists for host immune recognition of ctaC during infection?

Several lines of evidence indicate that ctaC is recognized by host immune systems during R. conorii infection. Immunization studies with recombinant ctaC have demonstrated that guinea pigs develop specific antibodies that recognize both the recombinant protein and native ctaC in R. conorii lysates, confirming the protein's immunogenicity . The protective efficacy of these immune responses, as evidenced by resistance to subsequent challenge with live R. conorii, suggests that antibodies against ctaC can effectively target the bacterium during infection . The location of ctaC at the bacterial surface, with portions potentially exposed to the extracellular environment, makes it accessible to host immune recognition mechanisms including antibodies and pattern recognition receptors . Transcriptomic analysis of R. conorii within human infection sites shows upregulation of genes associated with DNA repair, suggesting bacterial responses to DNA-damaging agents generated by host cells as part of antimicrobial defense mechanisms, which would affect all bacterial components including respiratory apparatus . While direct evidence of human immune responses specifically targeting ctaC during natural infection remains limited, the combined findings from experimental immunization studies and bacterial gene expression patterns during infection strongly suggest that ctaC contributes to the antigenic profile recognized by host immune systems during rickettsial infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.