Recombinant Rickettsia conorii Probable intracellular septation protein A (RC0539)

Shipped with Ice Packs
In Stock

Description

Table 1: Recombinant RC0539 Properties

PropertyDetails
Host SystemEscherichia coli (optimized for soluble expression)
TagPolyhistidine (His-tag) at N- or C-terminus
Storage ConditionsTris-based buffer with 50% glycerol; stable at -20°C or -80°C
Purity>90% (verified by SDS-PAGE and Western blot)

Role in Rickettsia conorii Biology

While direct experimental evidence for RC0539’s function is limited, its designation as a septation protein implies involvement in:

  • Cell Division: Mediating septum formation during bacterial replication.

  • Intracellular Survival: Potential interactions with host cell machinery to facilitate pathogen persistence .

Notably, Rickettsia species rely on host metabolic pathways due to their reduced genomes . RC0539 may contribute to metabolic adaptations, though this remains speculative without targeted studies.

Production Workflow:

  1. Gene Cloning: The rc0539 gene is amplified from R. conorii genomic DNA and inserted into an E. coli expression vector .

  2. Expression: Induced under optimized conditions (e.g., IPTG induction) .

  3. Purification: Affinity chromatography using the His-tag, followed by buffer exchange .

Applications in Research:

  • Diagnostic Tool: Used in ELISA kits to detect anti-Rickettsia antibodies in patient sera .

  • Antigenic Studies: Mapping immune responses to R. conorii infections .

  • Functional Studies: Investigating bacterial cell division mechanisms (in vitro assays) .

Research Gaps and Future Directions

  • Mechanistic Insights: No studies have directly validated RC0539’s role in septation or virulence. Comparative proteomics (e.g., SWATH-MS) could clarify its interaction with host pathways .

  • Vaccine Potential: While recombinant Rickettsia proteins like OmpB have shown promise in vaccines , RC0539 remains unexplored in this context.

  • Structural Biology: Cryo-EM or X-ray crystallography could resolve its 3D structure and functional domains.

Comparative Context with Other Rickettsia Proteins

  • APRc (RC1339): A retropepsin-like aspartic protease in R. conorii involved in processing outer membrane proteins (e.g., Sca5/OmpB) . Unlike RC0539, APRc has confirmed enzymatic activity and host interactions.

  • Srf Effectors: Novel secreted factors (e.g., SrfD) in Rickettsia parkeri modulate host ER functions . RC0539’s secretion status remains unverified.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery times may vary based on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
yciB; RC0539; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
RC0539
Target Protein Sequence
MLKLLSEIGPVIAFFAGFFYGGGIQHATLYMLITSVICITLCYVIDKKVSKLSIISTTVL LVSGSITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKYALESIVRLKEESWITL SYRTAAFFFFMAVVNEVVWRNCSDETWVKFKVFGVIPITFIFILLQLPLLLKNKLPDSKI
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: rco:RC0539

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does RC0539 differ from other rickettsial proteins such as RC0497?

While both are proteins from Rickettsia conorii, RC0539 and RC0497 differ significantly in their structure and function. RC0539 is a probable intracellular septation protein , whereas RC0497 is a putative N-acetylmuramoyl-L-alanine amidase that has been found in the circulating blood of infected hosts . RC0497 has been developed as a biomarker for spotted fever rickettsial (SFR) infections detectable by lateral flow assay , while RC0539's potential as a diagnostic marker remains less explored. These proteins represent different aspects of rickettsial biology – RC0539 likely being involved in bacterial cell division processes, while RC0497 appears to interact with the host immune system during infection.

What expression systems are best suited for recombinant RC0539 production?

Based on available data, E. coli has been successfully used as an expression system for producing recombinant RC0539 with an N-terminal His-tag . This bacterial expression system has proven effective for generating full-length (1-180 amino acids) protein suitable for research applications. The protein is typically provided in lyophilized form with greater than 90% purity as determined by SDS-PAGE .

Expression SystemTagProtein LengthPurityStorage Form
E. coliHisFull Length (1-180)>90% (SDS-PAGE)Lyophilized powder

What are the recommended storage and handling conditions for recombinant RC0539?

For optimal stability and activity, recombinant RC0539 should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles . The protein is typically provided in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For reconstitution, it is recommended to:

  • Briefly centrifuge the vial prior to opening

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation)

  • Store working aliquots at 4°C for up to one week

Repeated freezing and thawing should be avoided to maintain protein integrity.

What experimental approaches are most effective for studying RC0539's role in bacterial septation?

Investigating RC0539's role in bacterial septation requires a multifaceted approach combining structural analysis, functional assays, and genetic manipulation. Researchers should consider:

  • Gene knockout/knockdown studies: Creating RC0539-deficient R. conorii strains to observe effects on cell division and morphology

  • Fluorescent protein tagging: Fusing RC0539 with fluorescent markers to visualize its localization during the cell cycle

  • Protein-protein interaction studies: Using pull-down assays, yeast two-hybrid screens, or co-immunoprecipitation to identify binding partners

  • Structural biology approaches: X-ray crystallography or cryo-EM to determine the three-dimensional structure

  • Comparative genomics: Analyzing RC0539 homologs across bacterial species to identify conserved functional domains

The transmembrane nature of RC0539 makes some of these approaches technically challenging, requiring specialized protocols for membrane protein analysis.

How can researchers determine if RC0539 interacts with host cell proteins during infection?

To investigate potential interactions between RC0539 and host proteins during infection, researchers could employ the following methodologies:

  • Bacterial two-hybrid systems: Adapted for membrane proteins to screen for potential interactions

  • Proximity labeling approaches: BioID or APEX2 fused to RC0539 to identify proximal proteins in infected cells

  • Cross-linking mass spectrometry: To capture transient interactions between RC0539 and host proteins

  • Immunoprecipitation followed by proteomics: Using anti-RC0539 antibodies to pull down potential interacting partners

  • RNA-seq analysis: To identify host genes whose expression changes in response to RC0539 exposure

These approaches should be complemented with validation studies such as co-localization by immunofluorescence microscopy and functional assays to confirm the biological relevance of identified interactions.

What methodological considerations are crucial when designing antibodies against RC0539?

Designing effective antibodies against RC0539 requires careful consideration of its membrane-associated nature. Key methodological approaches include:

  • Epitope selection: Identify hydrophilic, surface-exposed regions of RC0539 based on hydropathy analysis of its sequence. The amino acid sequence provided in the product information can be analyzed to identify potential immunogenic epitopes outside the transmembrane domains.

  • Peptide vs. whole protein immunization: Consider using synthetic peptides corresponding to extracellular or periplasmic domains rather than the full-length protein to avoid issues with membrane protein solubility.

  • Antibody format selection: Determine whether polyclonal or monoclonal antibodies are more appropriate based on the research application:

    • Polyclonal: Better for protein detection in multiple applications

    • Monoclonal: Superior specificity for particular epitopes

  • Validation strategy: Plan for comprehensive validation including:

    • Western blotting against recombinant RC0539

    • Immunofluorescence in Rickettsia-infected cells

    • Negative controls using related Rickettsia species

  • Cross-reactivity assessment: Test against related intracellular septation proteins from other bacterial species to ensure specificity.

What are the challenges in interpreting proteomics data involving RC0539 during Rickettsia infection?

Interpreting proteomics data for RC0539 during infection presents several challenges:

  • Low abundance: As a probable septation protein, RC0539 may be expressed at relatively low levels compared to other bacterial proteins, potentially falling below detection thresholds in whole-cell proteomics.

  • Membrane protein enrichment: Standard proteomics sample preparation may inadequately solubilize membrane proteins like RC0539, necessitating specialized extraction protocols to ensure comprehensive coverage.

  • Host protein interference: The overwhelming abundance of host proteins in infection models can mask bacterial proteins, requiring either targeted approaches or extensive fractionation.

  • Post-translational modifications: Potential modifications of RC0539 during infection may alter its detection profile and functional characteristics.

  • Temporal expression patterns: RC0539 expression may vary across the infection cycle, requiring time-course analyses to capture its dynamic role.

To address these challenges, researchers should consider:

  • Implementing membrane protein-specific extraction methods

  • Using stable isotope labeling for quantitative comparisons

  • Employing targeted proteomic approaches (SRM/PRM) for sensitive detection

  • Correlating proteomics data with transcriptomics and functional assays

How does RC0539 compare to RC0497 in terms of diagnostic potential for Spotted Fever Rickettsioses?

While RC0497 has demonstrated promise as a diagnostic biomarker for Spotted Fever Rickettsioses (SFRs), the diagnostic utility of RC0539 remains largely unexplored. Current research indicates:

  • RC0497 diagnostic development: RC0497 has been successfully used in a lateral flow assay (LFA) with 95.5% sensitivity for detecting R. rickettsii in guinea pigs and R. conorii in mice . The concentration of RC0497 in infected animal sera ranges from 0.1 to 1.1 ng/ml as determined by stable isotope dilution–parallel reaction monitoring mass spectrometry (SID-PRM-MS) .

  • RC0539 diagnostic potential: There is currently limited evidence regarding RC0539's presence in host circulation during infection or its potential utility as a diagnostic marker. As an intracellular septation protein, RC0539 may remain primarily within bacterial cells rather than being secreted or released into circulation.

  • Comparative advantages/disadvantages:

FeatureRC0497RC0539
Protein functionN-acetylmuramoyl-L-alanine amidaseProbable intracellular septation protein
Detection in host circulationConfirmed in experimental modelsNot yet established
Diagnostic assay developmentLFA prototype developedNo reported diagnostic applications
Cross-reactivity with other Rickettsia speciesConserved across SFG rickettsiaeConservation requires further investigation

Researchers interested in exploring RC0539's diagnostic potential would need to first establish whether it can be detected in host circulation during infection and at what concentrations, followed by development of sensitive detection methods.

What are the best practices for validating antibody specificity against RC0539?

Validating antibody specificity for RC0539 requires a comprehensive approach:

  • Positive controls: Test against recombinant RC0539 protein across multiple applications (Western blot, ELISA, immunofluorescence).

  • Negative controls: Include:

    • Samples from uninfected cells/tissues

    • Samples from cells infected with RC0539 knockout strains (if available)

    • Pre-immune serum controls

  • Cross-reactivity testing: Evaluate potential cross-reactivity with:

    • Related proteins from other Rickettsia species

    • Host proteins with similar domains

    • Other bacterial septation proteins

  • Peptide competition assays: Pre-incubate antibodies with the immunizing peptide to demonstrate signal reduction in specific binding.

  • Multiple antibody validation: Use antibodies targeting different epitopes of RC0539 to confirm consistent localization and expression patterns.

Document all validation steps methodically, including positive and negative control results, to establish antibody reliability for downstream applications.

How can researchers optimize protein extraction protocols for membrane-associated proteins like RC0539?

Extracting membrane-associated proteins like RC0539 requires specialized protocols to overcome solubility challenges:

  • Detergent selection: Test multiple detergents for optimal extraction:

    • Mild detergents (Triton X-100, CHAPS) for preserving protein-protein interactions

    • Stronger detergents (SDS, sodium deoxycholate) for maximum extraction efficiency

    • Novel detergents (DDM, LMNG) specifically designed for membrane protein solubilization

  • Buffer optimization:

    • Include stabilizing agents (glycerol, trehalose)

    • Adjust ionic strength for optimal solubilization

    • Maintain appropriate pH based on protein characteristics

  • Physical disruption methods:

    • Sonication or mechanical disruption for initial cell lysis

    • Freeze-thaw cycles for membrane disruption

    • French press or microfluidizer for complete membrane solubilization

  • Two-phase extraction systems:

    • Aqueous two-phase systems for enrichment of membrane proteins

    • Sequential extraction with increasing detergent strengths

  • Specialized kits:

    • Commercial membrane protein extraction kits

    • Phase-transfer surfactants for improved mass spectrometry compatibility

Each extraction method should be evaluated for both yield and maintenance of protein structure/function to determine the optimal approach for specific downstream applications.

What are the key considerations for designing functional assays to study RC0539's septation activity?

Designing functional assays for RC0539's septation activity requires careful consideration of its biological context:

  • Bacterial growth and division assays:

    • Complementation studies in yciB-deficient E. coli strains

    • Growth curves and morphology analysis in RC0539 knockdown/knockout Rickettsia

    • Time-lapse microscopy to observe septation defects

  • Protein localization studies:

    • Immunofluorescence microscopy during different stages of cell division

    • Fluorescent protein fusions to track dynamic localization patterns

    • Super-resolution microscopy for detailed septation site visualization

  • Interaction partner identification:

    • Pull-down assays with recombinant RC0539

    • Bacterial two-hybrid screens for protein-protein interactions

    • Chemical cross-linking followed by mass spectrometry

  • Structural studies:

    • Lipid bilayer reconstitution for functional analysis

    • Electron microscopy of septation complexes

    • Molecular dynamics simulations based on structural data

  • Biochemical activity assays:

    • Membrane binding assays

    • Peptidoglycan interaction studies

    • ATP/GTP hydrolysis measurements if enzymatic activity is suspected

The assays should incorporate appropriate controls and be validated with known septation proteins to establish their reliability for studying RC0539's specific functions.

What are the most promising approaches for studying RC0539's role in Rickettsia pathogenesis?

Future research on RC0539's role in pathogenesis could focus on:

  • Genetic manipulation systems:

    • Developing inducible expression systems for RC0539 in Rickettsia

    • CRISPR-Cas9 approaches for precise genome editing

    • Transposon mutagenesis to identify genetic interactions

  • Animal infection models:

    • Evaluating RC0539-modified strains in established guinea pig or mouse models

    • Analyzing tissue-specific effects of RC0539 alteration

    • Developing in vivo imaging approaches to track infection progression

  • Comparative studies across Rickettsia species:

    • Analyzing sequence conservation and variation of RC0539 homologs

    • Correlating structural differences with virulence phenotypes

    • Examining expression patterns in different host environments

  • Host-pathogen interaction studies:

    • Investigating effects of RC0539 on host cell division and cytoskeleton

    • Examining potential immunomodulatory functions

    • Exploring interactions with host membrane proteins

  • Systems biology approaches:

    • Multi-omics integration to place RC0539 in cellular networks

    • Computational modeling of septation processes

    • Machine learning analysis of large-scale experimental data

These approaches should be prioritized based on available resources and specific research questions, with initial studies focusing on establishing fundamental aspects of RC0539 function before progressing to more complex pathogenesis models.

What technological advances could enhance our understanding of RC0539's structure-function relationship?

Emerging technologies that could advance our understanding of RC0539 include:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy for membrane protein structures

    • Integrative structural biology combining multiple data sources

    • In-cell NMR for studying proteins in their native environment

  • Single-molecule approaches:

    • Single-molecule FRET to examine conformational changes

    • High-speed AFM for visualizing dynamic processes

    • Optical tweezers for measuring mechanical properties

  • Artificial intelligence applications:

    • AlphaFold2 and similar tools for structure prediction

    • Machine learning for functional annotation

    • Neural networks for predicting protein-protein interactions

  • Advanced imaging technologies:

    • Super-resolution microscopy beyond the diffraction limit

    • Correlative light and electron microscopy (CLEM)

    • Expansion microscopy for enhanced visualization

  • Novel protein engineering approaches:

    • Nanobodies for tracking and manipulating proteins in living cells

    • Optogenetic tools for controlling protein function

    • Proximity labeling for mapping protein neighborhoods

These technological advances could provide unprecedented insights into how RC0539's structure relates to its function in bacterial septation and potentially in pathogenesis during Rickettsia infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.