Recombinant Rickettsia conorii Protein-export membrane protein SecG (secG)

Shipped with Ice Packs
In Stock

Description

Introduction to the Sec Pathway in Rickettsia conorii

The Sec pathway is a conserved protein secretion system in Gram-negative bacteria, including Rickettsia species. Key components include:

  • SecYEG: A heterotrimeric translocon forming a channel for protein translocation across the inner membrane.

  • SecA: An ATPase that binds preproteins and drives their translocation via conformational changes.

  • Signal Peptidases (SPases): Enzymes (e.g., LepB, LspA) that cleave signal peptides from secreted proteins.

Role of SecG in Bacterial Sec Translocon

In model organisms (e.g., E. coli), SecG enhances SecYEG stability and facilitates preprotein translocation. Structural studies reveal:

  • SecG Structure: Two transmembrane domains connected by a cytosolic loop.

  • Function: Stabilizes the SecYEG complex, particularly under stress conditions.

FunctionMechanismRelevance to Rickettsia
Complex StabilityBinds to SecY, preventing degradation by proteases (e.g., FtsH in E. coli)Hypothetical in Rickettsia
Translocation EfficiencyEnhances SecA-dependent preprotein movement through the channelUnconfirmed in R. conorii

Data synthesized from general SecYEG studies .

Sec Pathway Components in Rickettsia conorii

While SecG is not directly studied in R. conorii, other Sec components are well-documented:

ComponentFunctionEvidence in Rickettsia
SecAATP-dependent translocation motorExpressed, but species-specific C-terminal domain limits E. coli complementation
SecY/SecECore channel for membrane insertion/translocationPredicted from genomic homology; functional studies pending
LepBSPase I for signal peptide cleavageDemonstrated in R. rickettsii and R. typhi
LspASPase II for lipoprotein maturationConfirmed in R. typhi

Data from .

Research Gaps and Challenges

  • Lack of Direct Studies: No peer-reviewed studies explicitly address R. conorii SecG.

  • Species-Specific Interactions: Rickettsia SecA and other components show reduced cross-species functionality (e.g., Rickettsia SecA cannot complement E. coli SecA mutants unless chimeric constructs are used) .

  • Genomic Context: secG is likely present in R. conorii genomes, but functional validation is absent.

Hypothetical Recombinant SecG Applications

If engineered, recombinant R. conorii SecG could serve as:

  1. Structural Biology Tool: To study Rickettsia-specific SecYEG interactions.

  2. Vaccine Target: If critical for virulence, SecG could be a candidate for therapeutic intervention.

  3. Diagnostic Marker: As a conserved membrane protein, SecG may elicit cross-reactive antibodies.

Methodological Recommendations

To advance SecG research in R. conorii:

  1. Recombinant Protein Production:

    • Cloning: Amplify secG from R. conorii genomic DNA using primers targeting conserved regions.

    • Expression: Use E. coli systems with optimized codon usage for Rickettsia genes.

  2. Functional Assays:

    • In Vitro Translocation: Test SecG’s role in artificial liposome systems with Rickettsia SecYEG.

    • Co-IP/MS: Identify SecG interactions with SecY/SecE in Rickettsia membranes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific needs. Please indicate your preferred format when placing your order, and we will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on your purchasing method and location. We recommend reaching out to your local distributors for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing of the product is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms maintain a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles to maintain product integrity.
Tag Info
The tag type will be determined during the manufacturing process.
For specific tag types, please inform us prior to production, and we will prioritize your request in the development process.
Synonyms
secG; RC0109; Protein-export membrane protein SecG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
secG
Target Protein Sequence
MIDILLFVHITIAILLIIVILMQRSGSDGISSISGGNNMGVVSAKTVGNFLTKSTIILTT LFLINAIVLANLSSKKKSDLVSKINEIEENQAENSLPIAK
Uniprot No.

Target Background

Function
This protein plays a crucial role in protein export, participating in the early stages of protein translocation across cellular membranes.
Database Links

KEGG: rco:RC0109

Protein Families
SecG family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the key recombinant proteins of Rickettsia conorii used in diagnostics and vaccine research?

The primary recombinant proteins of R. conorii with demonstrated research utility are the outer membrane proteins OmpA and OmpB. These proteins have been extensively studied for their antigenic properties and potential applications. OmpA and OmpB serve as major surface antigens that can elicit strong antibody responses in infected hosts. Research indicates that specific regions of these proteins, such as OmpA₁₃₅₀₋₁₇₈₄, OmpB₈₀₁₋₁₂₆₉, and OmpB₁₂₂₇₋₁₆₃₄, are particularly valuable as diagnostic antigens . Additionally, a 198-kDa protein of R. conorii (likely OmpB) has shown promise as a potential vaccine candidate when expressed in E. coli and used to immunize guinea pigs .

How do OmpA and OmpB compare in their diagnostic sensitivity and specificity for rickettsial diseases?

Based on ELISA testing of serum samples from febrile patients and uninfected controls, specific regions of both proteins demonstrate high diagnostic potential:

Protein RegionSensitivitySpecificityNotes
OmpA₁₃₅₀₋₁₇₈₄90%100%Detected 18/20 positive samples
OmpB₈₀₁₋₁₂₆₉90%100%Comparable to OmpA₁₃₅₀₋₁₇₈₄
OmpB₁₂₂₇₋₁₆₃₄95%95%Slightly higher sensitivity

These truncated regions perform comparably to commercial ELISA kits that use whole OmpA and OmpB antigens, suggesting that targeting specific immunodominant regions may be sufficient for accurate diagnosis while potentially reducing cross-reactivity with other bacterial proteins .

What expression systems are most effective for producing recombinant R. conorii proteins?

The E. coli expression system using pMAL-c2X plasmids has proven effective for R. conorii protein production. This system expresses the rickettsial proteins as fusion proteins with maltose-binding protein (MBP), which can enhance solubility and facilitate purification. Research demonstrates successful expression of multiple fragments of both OmpA and OmpB using this approach . Specifically, six fragments of OmpA and four fragments of OmpB have been successfully expressed in E. coli using this method . Alternative expression systems such as E. coli JM107 have also demonstrated success in expressing the 198-kDa protein of R. conorii .

How should researchers design cloning strategies for R. conorii OmpA and OmpB genes?

Site-specific PCR primers are essential for successful cloning of OmpA and OmpB gene fragments. When targeting specific regions known to be immunogenic, researchers should:

  • Design primers that precisely amplify the desired fragments (e.g., OmpA₁₃₅₀₋₁₇₈₄, OmpB₈₀₁₋₁₂₆₉, OmpB₁₂₂₇₋₁₆₃₄)

  • Include appropriate restriction sites for directional cloning into expression vectors

  • Ensure primers maintain the correct reading frame for fusion protein expression

  • Consider codon optimization for expression in E. coli if needed

For successful cloning of larger fragments, such as the 5.5-kilobase HindIII fragment of R. conorii genomic DNA used in vaccine development research, gene probe approaches based on homologous sequences from related species (e.g., R. rickettsii) can be effective .

What are the immunological mechanisms behind protective immunity from recombinant R. conorii protein vaccines?

Recombinant R. conorii proteins, particularly the 198-kDa protein (likely OmpB), can induce protective immunity in animal models. Guinea pigs immunized with sonic lysates of E. coli expressing this recombinant protein developed antibodies that recognized R. conorii when tested by microimmunofluorescence antibody assay . Upon immunoblotting, these antisera specifically recognized the 198-kDa R. conorii protein and its 190-kDa analog in R. rickettsii .

The protection mechanism appears to involve:

  • Development of specific antibodies against surface-exposed epitopes

  • Neutralization of rickettsial attachment to host cells

  • Enhanced opsonization facilitating phagocytosis

  • Possible complement-mediated bacterial killing

Importantly, guinea pigs immunized with the recombinant protein demonstrated protection from experimental infections with homologous R. conorii strains and partial cross-protection against heterologous R. rickettsii strains, suggesting shared protective epitopes between these species .

How do specific regions of OmpA and OmpB proteins contribute to cross-reactivity between different Rickettsia species?

The cross-reactivity between different Rickettsia species likely stems from conserved epitopes within OmpA and OmpB proteins. Research demonstrates that guinea pigs immunized with recombinant R. conorii 198-kDa protein showed partial protection against R. rickettsii challenge, indicating immunological cross-reactivity . This cross-protection suggests shared protective epitopes between the 198-kDa protein of R. conorii and the 190-kDa analog in R. rickettsii .

Importantly, structural analysis reveals that while certain regions of these proteins may be highly conserved across the spotted fever group rickettsiae, other regions display greater sequence variability and may serve as species-specific diagnostic targets. Understanding these regions is critical for developing diagnostic assays that can differentiate between rickettsial species while maintaining high sensitivity for the target organism.

What purification strategies yield the highest quality recombinant R. conorii proteins?

Effective purification of recombinant R. conorii proteins typically involves:

  • Expression as fusion proteins with tags that facilitate purification (e.g., MBP-fusion proteins)

  • Initial clarification of bacterial lysates through centrifugation

  • Affinity chromatography using the fusion partner (e.g., amylose resin for MBP-fusion proteins)

  • Optional cleavage of the fusion tag if required for downstream applications

  • Further purification by ion-exchange or gel filtration chromatography if needed

  • Quality control using SDS-PAGE and immunoblotting

The pMAL-c2X expression system used for OmpA and OmpB fragments facilitates purification through the MBP fusion tag, which binds specifically to amylose resin and can be eluted using maltose . For verification of purified proteins, monospecific polyclonal antisera or monoclonal antibodies can confirm identity through immunoblotting .

How can researchers optimize ELISA protocols for diagnostic applications of recombinant R. conorii proteins?

Optimization of ELISA protocols for recombinant R. conorii proteins should include:

  • Antigen selection: Focus on high-performing regions like OmpA₁₃₅₀₋₁₇₈₄, OmpB₈₀₁₋₁₂₆₉, and OmpB₁₂₂₇₋₁₆₃₄

  • Antigen concentration: Titrate to determine optimal coating concentration

  • Blocking conditions: Optimize to reduce background while maintaining sensitivity

  • Sample dilution: Determine appropriate serum dilutions to maximize signal-to-noise ratio

  • Detection system: Select appropriate secondary antibodies and substrates

  • Controls: Include positive and negative control sera for quality assurance

  • Cut-off determination: Establish appropriate thresholds for positive results

When evaluating new assays, comparison with commercial kits that contain whole OmpA and OmpB antigens provides a valuable benchmark. In validation studies, recombinant protein-based ELISAs have achieved sensitivities of 90-95% and specificities of 95-100% compared to commercial assays .

How should researchers evaluate sensitivity and specificity of recombinant R. conorii protein-based diagnostic assays?

Proper evaluation of diagnostic assays requires:

  • Reference standard: Use a well-established method (e.g., commercial ELISA kit) as comparison

  • Sample selection: Test adequate numbers of both positive and negative samples

  • Sensitivity calculation: Determine proportion of true positives correctly identified

  • Specificity calculation: Determine proportion of true negatives correctly identified

  • Statistical analysis: Calculate confidence intervals for sensitivity and specificity estimates

  • Cross-reactivity testing: Evaluate potential false positives from related pathogens

In the evaluation of recombinant OmpA and OmpB fragments, researchers tested 40 serum samples (20 positive, 20 negative by commercial kit). This approach allowed calculation of sensitivity (e.g., 18/20 = 90% for OmpA₁₃₅₀₋₁₇₈₄) and specificity (e.g., 20/20 = 100% for OmpA₁₃₅₀₋₁₇₈₄) .

What are the primary technical challenges in developing recombinant protein-based vaccines for R. conorii?

Development of recombinant protein-based vaccines for R. conorii faces several technical challenges:

  • Protein folding: Ensuring recombinant proteins maintain native conformation and epitope presentation

  • Adjuvant selection: Identifying adjuvants that enhance immunogenicity without excessive reactogenicity

  • Delivery systems: Developing appropriate formulations for effective antigen presentation

  • Cross-protection: Addressing partial protection against heterologous species

  • Durability: Ensuring long-lasting protective immunity

  • Safety assessment: Thorough evaluation for adverse effects

Early research demonstrated that guinea pigs immunized with sonic lysates of E. coli expressing the R. conorii 198-kDa protein were protected from experimental infections with the homologous strain and partially protected from R. rickettsii infection . This suggests that with appropriate optimization, recombinant protein vaccines could potentially provide protection against multiple rickettsial species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.