Recombinant Rickettsia conorii Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Rickettsia conorii Protein Translocase Subunit SecD (secD) is a bacterial membrane protein involved in the Sec secretion system, which facilitates the transport of newly synthesized proteins across the cytoplasmic membrane . This recombinant variant is engineered with an N-terminal His tag for purification and research applications, enabling studies on rickettsial protein translocation mechanisms .

Applications in Research

  1. Mechanistic Studies: Used to investigate protein export pathways in Rickettsia .

  2. Antigen Characterization: Though not yet tested, conserved proteins like SecD may serve as targets for serodiagnostic assays, similar to other rickettsial antigens (e.g., Sca1, groEL) .

  3. Drug Development: Understanding SecD’s structure could aid in designing inhibitors targeting bacterial secretion systems .

Comparative Analysis with Homologs

The secD gene is conserved across bacterial species, including Mycobacterium leprae . A comparison of key features:

FeatureR. conorii SecD M. leprae SecD
Amino Acid Length518571
UniProt IDQ92H77P38387
Expression SystemE. coliE. coli
Key DomainsTransmembrane, periplasmicTransmembrane, ATP-binding

Challenges and Future Directions

  • Functional Studies: Limited data exist on SecD’s specific interactions in R. conorii. Co-immunoprecipitation assays with SecF or other translocase subunits could clarify its role .

  • Diagnostic Potential: Cross-reactivity studies with sera from rickettsiosis patients are needed to evaluate SecD as a serological marker .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your requirement whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are sent with standard blue ice packs. If dry ice packaging is preferred, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life of our proteins is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. The shelf life of lyophilized protein is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development whenever possible.
Synonyms
secD; RC0894; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-518
Protein Length
full length protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
secD
Target Protein Sequence
MQKLPKWKIFLSIICTVFAVICALPNFMQVNSKFLPHDSVNLGLDLRGGAHLLLDVDFDT YLNDSMENLADTLRKNFREDKIGYKNLLVRQNSIQLEVRSPEKLKPLKKIINKIDPEIIA EVNENKIKLSYSESRLNDLLNKVVDQSIEIVRMRVDSTGTKEPTLQKQGDKHILLQVPGE ENPSYLKNILGKTAKLTFHLVDENANIEEAVKGHVPVGSMLVKGDNASHGEYYVVIKKKV VLGGDQLTTASASFDQNSQAVVAFSFNNLGSKIFGEITKNNIGKRLAIVLDNKLLSAPTI NGAIMGGSGIITGNFTVESANELALLLRAGSLPAPLKIIEERSIGPNLGADSIESGKKAG LIGFIAVCIFMVWSYGVLGLFANIALSLALLYILALLSLFQATLTLPGIAGIILTMGMAV DANVLIYERIKEELHKGVSTLYAIRTGFESAFATILDANLTTLIVAFLLYIFGVGAIKGF AVALTIGIISSMFSAIIITKLLIDIWVQYFKPKKLGLV
Uniprot No.

Target Background

Function
SecD is a component of the Sec protein translocase complex, interacting with the SecYEG preprotein conducting channel. It utilizes the proton motive force (PMF) to complete protein translocation, following the ATP-dependent function of SecA.
Database Links

KEGG: rco:RC0894

Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of SecD in Rickettsia conorii?

SecD functions as an essential component of the bacterial protein translocation machinery, specifically as part of the Sec pathway. In R. conorii, it forms a complex with SecF (SecDF complex) that interacts with the core SecYEG translocon to facilitate protein export across the cytoplasmic membrane. The SecDF complex utilizes the proton motive force to drive the later stages of protein translocation, assisting in the release of translocating proteins from the SecYEG channel. This function is critical for the proper secretion of virulence factors and other proteins necessary for R. conorii's intracellular lifecycle and pathogenesis in human hosts .

How does the SecD protein structure in R. conorii compare to homologs in other bacterial species?

While specific structural data for R. conorii SecD remains limited, comparative analysis with homologous proteins suggests it likely contains multiple transmembrane domains and large periplasmic domains that interact with translocating proteins. Based on information from related bacterial SecD proteins like those in Sebaldella termitidis, the protein likely contains approximately 400-450 amino acids with several predicted membrane-spanning regions . The periplasmic domains are particularly important for function, as they interact directly with substrate proteins during translocation. Conserved residues across bacterial species indicate functional domains essential for proton translocation coupled to protein movement, though R. conorii may have unique structural adaptations related to its obligate intracellular lifestyle.

What expression systems are most suitable for producing recombinant R. conorii SecD?

For recombinant expression of R. conorii SecD, several expression systems can be considered:

Expression SystemAdvantagesChallengesBest Application
E. coli BL21(DE3)High yield, simple protocols, N-terminal tagging optionsPotential for inclusion body formationInitial expression screening
E. coli C41/C43Better for membrane proteins, reduces toxicityLower yield than standard strainsFunctional studies requiring properly folded protein
Insect cell systemsBetter post-translational modificationsMore complex, higher costStructural studies requiring native conformation
Cell-free systemsAvoids toxicity issuesLimited scaleProteins toxic to living expression hosts

Most successful expressions utilize an N-terminal His-tag fusion for easier purification, similar to the approach used for other bacterial protein translocase systems . Codon optimization for E. coli expression is recommended, as R. conorii has different codon usage patterns. Temperature optimization is crucial, with lower temperatures (16-20°C) often improving folding of membrane proteins like SecD.

What purification strategies yield the highest purity R. conorii SecD protein suitable for functional and structural studies?

A multi-step purification strategy is recommended for obtaining high-purity R. conorii SecD:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins for His-tagged SecD, with careful optimization of imidazole concentrations to minimize non-specific binding .

  • Intermediate purification: Ion-exchange chromatography can separate SecD from proteins with different charge properties. The choice between anion or cation exchange depends on SecD's isoelectric point .

  • Polishing step: Size-exclusion chromatography for final purification and buffer exchange, which also confirms protein homogeneity and removes aggregates .

Critical considerations include:

  • Membrane proteins like SecD require detergents throughout purification (typically DDM, LDAO, or C12E8)

  • Protein stability must be monitored at each step (dynamic light scattering, thermal shift assays)

  • Purification buffers should include glycerol (typically 10%) and potentially stabilizing additives

  • Tag removal may be necessary for certain applications, requiring optimization of protease digestion conditions

This approach typically yields protein with >95% purity suitable for both functional assays and crystallization trials.

How can researchers effectively study the interaction between SecD and other components of the Sec translocation machinery in R. conorii?

Studying SecD interactions with other Sec pathway components requires specialized approaches:

  • Co-purification studies: Tandem affinity purification using differentially tagged components can identify stable interaction partners in the native context.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding affinities between purified SecD and other Sec components, providing association and dissociation kinetics.

  • Crosslinking coupled with mass spectrometry: Chemical crosslinkers can capture transient interactions during the translocation process, with mass spectrometry identifying interaction sites.

  • Förster resonance energy transfer (FRET): For monitoring dynamic interactions in real-time by labeling SecD and potential partners with appropriate fluorophores.

  • Bacterial two-hybrid systems: Modified for R. conorii proteins to detect binary protein-protein interactions in vivo.

These approaches should be used complementarily to build a comprehensive interaction network. Researchers should pay particular attention to interactions with SecF (forming the SecDF complex), SecYEG (the core translocon), and substrate proteins. Membrane mimetics (nanodiscs or liposomes) can provide a more native-like environment for studying these transmembrane protein interactions .

What are the differences in SecD expression and function during R. conorii infection of human cells versus tick cells?

Research on R. conorii gene expression during infection of different host cells suggests that secretion systems may be differentially regulated between human and arthropod hosts . While specific data on SecD expression is limited, comparative analysis approaches can reveal host-specific patterns:

  • Transcriptomic profiling: RNA-Seq analysis of R. conorii during infection of human microvascular endothelial cells (HMECs) versus tick cells (AAE2) can reveal differences in secD transcript levels . Similar to the differential expression observed with small RNAs like Rc_sR35 and Rc_sR42, SecD may show host-specific expression patterns.

  • Proteomic analysis: Mass spectrometry-based approaches can quantify SecD protein levels and post-translational modifications in different infection models.

  • Functional assays: Measuring protein translocation efficiency in bacteria isolated from different host cell types can reveal functional differences in the SecD-containing machinery.

This differential regulation likely reflects adaptation to distinct host environments, potentially affecting the secretion of host-specific virulence factors. Understanding these differences could reveal why certain Rickettsia proteins are preferentially expressed or secreted in human cells, contributing to pathogenesis and disease progression.

What are the critical parameters for developing functional assays to assess R. conorii SecD activity?

When designing functional assays for R. conorii SecD, researchers should consider these critical parameters:

  • Reconstitution conditions: The lipid composition of proteoliposomes significantly affects SecD function. A mixture of E. coli polar lipids with phosphatidylcholine at specific ratios often provides optimal activity.

  • Energy coupling: Since SecDF utilizes the proton motive force, assays should include methods to generate and measure membrane potential (e.g., valinomycin/potassium gradients).

  • Selection of substrate proteins: Ideal substrates include native R. conorii proteins known to be Sec-dependent or model substrates with R. conorii-specific signal sequences.

  • Detection methods: Fluorescently labeled substrates allow real-time monitoring of translocation, while protease protection assays can distinguish between translocated and non-translocated populations.

  • Assay validation: Include positive controls (fully functional E. coli Sec components) and negative controls (inactivated SecD mutants).

A typical assay workflow might include:

  • Reconstitution of purified SecD, SecF, and SecYEG into liposomes

  • Addition of ATP, SecA, and fluorescently labeled preprotein

  • Establishment of proton gradient

  • Measurement of fluorescence changes associated with translocation

  • Verification by protease protection

These assays should be performed across a range of pH values (6.5-8.0) and temperatures (25-37°C) to determine optimal conditions for R. conorii SecD function.

How can small RNA regulatory mechanisms be investigated in relation to SecD expression in R. conorii?

Based on recent findings regarding small regulatory RNAs in R. conorii , investigating their potential role in regulating SecD expression requires a systematic approach:

  • Bioinformatic prediction: Analyze the secD mRNA sequence for potential binding sites of known R. conorii small RNAs (Rc_sRs) using tools like IntaRNA or RNAhybrid.

  • Expression correlation analysis: Examine transcriptomic datasets for correlation patterns between secD and small RNA expression across different conditions.

  • Direct binding assays: In vitro techniques such as electrophoretic mobility shift assays (EMSA) or RNA footprinting can confirm physical interactions between candidate small RNAs and secD mRNA.

  • Functional validation: Overexpression or knockdown of candidate regulatory small RNAs followed by measurement of SecD protein levels and translocation activity.

  • Reporter systems: Construction of GFP or luciferase reporters fused to the secD 5'-UTR and coding sequence to monitor the effect of small RNAs on expression.

This approach has successfully identified regulatory relationships in R. conorii, such as the interaction between Rc_sR42 and cydA , and could reveal similar mechanisms controlling SecD expression during different stages of the infectious cycle.

What strategies can overcome the challenges of generating recombinant membrane proteins like SecD from obligate intracellular pathogens?

Generating functional recombinant membrane proteins from obligate intracellular pathogens like R. conorii presents unique challenges. Effective strategies include:

  • Codon optimization: Comprehensive codon optimization for the expression host, not just rare codons, improves translation efficiency and yield.

  • Fusion partners: N-terminal fusions with highly soluble proteins (MBP, SUMO, Trx) can enhance expression and solubility, provided they can be efficiently removed.

  • Membrane mimetics: Selection of appropriate detergents is crucial; screening panels of detergents (maltosides, glucosides, fos-cholines) identifies optimal conditions for extraction and stability.

  • Construct optimization: Creating truncated constructs or chimeric proteins containing stable domains from homologous proteins improves expression.

  • Expression host engineering: Using specialized E. coli strains with enhanced membrane protein production capacity (C41/C43, Lemo21) or those with additional chaperones.

A systematic approach testing multiple constructs, fusion partners, and expression conditions in parallel yields the highest probability of success. When expressing SecD specifically, maintaining the native conformation is essential for functional studies, often requiring co-expression with SecF to form the stable SecDF complex .

How should researchers interpret contradictory results from different SecD functional assays?

When faced with contradictory results from different SecD functional assays, researchers should follow this systematic approach:

  • Methodological comparison: Create a detailed comparison table of experimental conditions:

ParameterAssay 1Assay 2Assay 3Potential Impact
Detergent/lipidDDMLDAONanodiscsProtein conformation
pH7.56.88.0Proton gradient efficiency
Temperature25°C37°C30°CEnzyme kinetics
Buffer componentsHEPESTrisPhosphateIonic interactions
Protein concentration0.1 μM1 μM10 μMOligomerization state
  • Biological context evaluation: Consider whether contradictions reflect true biological variability rather than technical artifacts. For example, R. conorii SecD may function differently depending on the infection stage or host cell type .

  • Integration of multiple datatypes: Combine structural, biochemical, and genetic data to develop a unified model that explains apparent contradictions.

  • Validation with orthogonal approaches: Confirm key findings using methodologically distinct techniques that address the same biological question.

  • Consideration of protein quality: Assess protein homogeneity, stability, and conformation to ensure that differences are not due to variable protein quality between experiments.

What bioinformatic approaches can identify potential SecD substrates and interaction partners in R. conorii?

Comprehensive bioinformatic identification of SecD substrates and interaction partners involves multiple computational strategies:

  • Signal peptide prediction: Tools like SignalP and Phobius can identify R. conorii proteins with Sec-type signal peptides, representing potential substrates.

  • Comparative genomics: Identification of SecD partners conserved across Rickettsia species but divergent from non-pathogenic bacteria may reveal pathogenesis-specific interactions.

  • Co-evolution analysis: Statistical coupling analysis (SCA) and direct coupling analysis (DCA) can identify proteins that show evolutionary correlation with SecD, suggesting functional relationships.

  • Protein-protein interaction network construction: Integration of multiple data types (genomic context, co-expression, text mining) using tools like STRING to predict functional associations.

  • Structural modeling and docking: Using homology models of R. conorii SecD to perform in silico docking with candidate partners, evaluating physical compatibility of interactions.

A typical workflow might involve:

  • Genome-wide signal peptide prediction to identify potential Sec substrates

  • Filtering candidates based on subcellular localization predictions

  • Prioritizing proteins with evidence for involvement in virulence

  • Validation of top candidates using experimental approaches

This approach has successfully identified SecD-dependent secreted proteins in other bacterial pathogens and can be adapted specifically for R. conorii .

How can researchers distinguish between direct and indirect effects when studying SecD function in R. conorii pathogenesis?

Distinguishing direct from indirect effects of SecD in pathogenesis requires carefully designed experimental approaches:

  • Conditional depletion systems: Rather than complete knockout (which may be lethal), regulated expression systems allow titration of SecD levels to observe dose-dependent effects.

  • Point mutation analysis: Creating SecD variants with mutations in specific functional domains can separate different aspects of SecD function (e.g., protein binding vs. proton translocation).

  • Temporal analysis: High-resolution time-course experiments during infection can reveal the sequence of events following SecD perturbation, helping separate primary from secondary effects.

  • Complementation strategies: Expressing SecD variants in trans under different promoters can rescue specific phenotypes, confirming direct relationships.

  • Targeted secretome analysis: Comparing the secretion efficiency of specific proteins with varying SecD levels identifies direct SecD-dependent substrates versus generally disrupted secretion.

Critical controls include comparing effects of SecD perturbation with disruption of other secretion systems, using structurally similar but functionally distinct membrane proteins as controls, and comprehensive monitoring of bacterial viability to distinguish specific effects from general stress responses.

How can structural studies of R. conorii SecD contribute to antimicrobial drug development?

Structural studies of R. conorii SecD can significantly advance antimicrobial development through several approaches:

  • Structure-based drug design: High-resolution structures of SecD, particularly co-crystal structures with bound substrates or inhibitors, can guide rational design of compounds that interfere with essential functions.

  • Identification of Rickettsia-specific features: Comparative structural analysis between R. conorii SecD and homologs from other bacteria can reveal unique structural elements that could be selectively targeted.

  • Binding pocket characterization: Computational identification and characterization of potential binding pockets, particularly those involved in proton translocation or substrate interaction.

  • Fragment-based screening: Using structural data to guide fragment-based drug discovery approaches, which can identify novel chemical scaffolds with activity against SecD.

  • Allosteric modulator development: Identification of allosteric sites that, when targeted, could inhibit SecD function through conformational changes rather than active site binding.

The essential nature of protein secretion for bacterial survival makes SecD an attractive target, while structural differences between bacterial and human membrane proteins can provide the selectivity needed for therapeutic development. Recent advances in cryo-electron microscopy have made structural studies of membrane protein complexes like SecD more feasible than ever before .

What role might SecD play in the adaptation of R. conorii to different host environments?

SecD likely plays a crucial role in R. conorii's adaptation to different host environments:

  • Host-specific protein secretion: Different sets of virulence factors may be secreted in human versus tick hosts, requiring adaptive regulation of the SecD-containing translocation machinery .

  • Temperature adaptation: The functionality of SecD may be optimized for different temperature ranges found in mammalian hosts (37°C) versus arthropod vectors (ambient temperature).

  • Nutrient acquisition systems: SecD-dependent secretion of nutrient transporters and acquisition proteins likely varies between nutrient-rich human cells and the more variable environment of tick cells.

  • Immune evasion: In human hosts, SecD-mediated secretion of immune evasion factors may be upregulated compared to tick cells where these factors are less necessary.

Comparative transcriptomic and proteomic studies of R. conorii in human microvascular endothelial cells versus tick cells have revealed differential expression patterns , suggesting that SecD activity may be tailored to specific host environments. This adaptive capacity could be a key factor in the pathogen's ability to successfully transition between arthropod vectors and human hosts during its lifecycle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.