Recombinant Rickettsia conorii Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Functional Role in the Sec Translocon

The Sec pathway in Rickettsia is critical for exporting virulence factors and surface proteins. SecF works alongside SecY and SecE to form a channel for preprotein translocation:

  • Mechanism: SecF stabilizes the SecYEG complex, ensuring efficient protein export .

  • Substrates: Includes autotransporter proteins (e.g., Sca1, Sca2) and ankyrin repeat proteins (e.g., RARP-1) .

  • Species-Specificity: Rickettsia SecA and SecF exhibit functional compatibility with E. coli systems but require chimeric constructs for full activity .

Key Studies

  1. Functional Complementation:

    • R. rickettsii SecF fused with E. coli SecA restored secretion in E. coli mutants, confirming functional homology .

    • R. typhi Sec substrates (84 proteins) were identified via PhoA fusion assays, highlighting SecF’s role in translocating virulence factors .

  2. Secretome Analysis:

    • The R. conorii secretome includes Sec-dependent proteins like Sca1 and Sca2, which mediate host cell adherence .

    • Recombinant Sca1 (rSca1) expressed in E. coli bound mammalian cells, demonstrating SecF’s role in exporting adhesins .

  3. Transcriptional Regulation:

    • secF and other Sec-related genes (lepB, lspA) are highly expressed during R. typhi infection, suggesting conserved roles in pathogenesis .

Applications of Recombinant SecF

ApplicationDetails
Vaccine DevelopmentRecombinant Sec substrates (e.g., rOmpB) have been tested as vaccine candidates against rickettsioses .
Drug Target ScreeningSecF inhibitors could disrupt protein secretion, offering therapeutic potential .
Pathogenesis StudiesUsed to dissect mechanisms of endothelial invasion and immune evasion .

Comparative Analysis of SecF Homologs

SpeciesIdentity to R. conorii SecFFunctional Role
R. rickettsii~90%Protein translocation, virulence factor export .
R. typhi~85%Substrate recognition in Sec translocon .
E. coli~30%Structural stabilization of SecYEG complex .

Challenges and Future Directions

  • Sequence Variability: Poor Sec SS predictions in Rickettsia complicate substrate identification .

  • Host Adaptation: SecF may exhibit host-specific interactions, as seen in R. typhi TolC-dependent secretion .

  • Therapeutic Potential: Targeting SecF could block secretion of virulence factors like Sca1 and RARP-1 .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
secF; RC0154; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
secF
Target Protein Sequence
MQIYPLRLLPNKIDFDFMNFKKVSYTFSIILSLISFIWIGIYKFNFGIDFAGGIVIEVRL DQAPDLPKMRGVLGKLGIGEVVLQNFGSERDLSIRFGSSSEENLMKNIELIKGFLQSNFP YKFEYRKVDFVGPQVGRQLIEAGAMAMLFSFLAIMVYIWVRFEWYFGLGILIALVHDVIL ALGFMSMTKLDFNLSTIAAVLTIIGYSVNDSVVIYDRIRENLRKYHKKNITEIINLSINE TLSRTILTVITTLLANLALILFGGEAIRSFSVLVFFGIIAGTYSSIFISAPILTMFVNRK FNKKVIER
Uniprot No.

Target Background

Function
SecF is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links

KEGG: rco:RC0154

Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rickettsia conorii and why is its SecF protein significant?

Rickettsia conorii is the causative agent of Mediterranean spotted fever, a tick-borne pathogen that primarily infects microvascular endothelium in humans . The SecF protein, as part of the bacterial Sec translocase system, plays a critical role in protein secretion and membrane protein integration. Understanding this protein can provide insights into rickettsial pathogenesis and potential targets for therapeutic intervention. The SecF protein functions as a component of the SecYEG-SecDF-YajC complex that mediates protein translocation across the bacterial membrane, an essential process for bacterial survival and virulence.

How are recombinant Rickettsia conorii proteins typically produced?

Recombinant Rickettsia conorii proteins, including SecF, are typically produced using heterologous expression systems. Based on common approaches for rickettsial proteins, expression systems may include:

Expression SystemAdvantagesLimitations
E. coliRapid growth, high yield, ease of genetic manipulationPotential misfolding, lack of post-translational modifications
Insect cellsBetter folding, some post-translational modificationsHigher cost, longer production time
Mammalian cellsNative-like folding and modificationsHighest cost, complex purification

For instance, in studies with other rickettsial proteins such as OmpA and OmpB, researchers have successfully used site-specific PCR primers to clone genes into expression vectors like pMAL-c2X, allowing for expression as fusion proteins with maltose-binding protein in Escherichia coli .

What purification methods are recommended for recombinant SecF protein?

Purification of recombinant SecF protein often requires a multi-step approach to ensure high purity while maintaining structural integrity. Based on methodologies used for similar rickettsial membrane proteins:

  • Initial capture using affinity chromatography (if expressed with tags like His6 or MBP)

  • Intermediate purification using ion exchange chromatography

  • Polishing step using size-exclusion chromatography (SEC)

SEC has proven particularly valuable for characterization and quality control of complex biotherapeutic products, including membrane proteins . For membrane proteins like SecF, detergent selection during purification is critical, with options including:

DetergentCMC (mM)Suitability for Membrane Proteins
DDM0.17Good for maintaining structure/function
LDAO1-2Good for crystallization
Triton X-1000.2-0.9Good for initial solubilization

Modifying SEC mobile-phase composition can significantly improve separation and stability of membrane proteins like SecF .

How can I verify the expression and integrity of recombinant SecF protein?

Verification of recombinant SecF expression and integrity requires multiple analytical techniques:

  • Western blotting: Using antibodies specific to SecF or fusion tags (like the Xpress-tag system used in similar studies)

  • Mass spectrometry: For accurate molecular weight determination and peptide mapping

  • Circular dichroism: To assess secondary structure integrity

  • Size-exclusion chromatography: To evaluate oligomeric state and aggregation tendency

For tagged constructs, reporter sequences like the Xpress-tag can be particularly useful for visualizing expressed proteins. In studies with other recombinant proteins, SDS-PAGE analysis typically reveals products of the expected molecular weight, which for SecF would be approximately 40-45 kDa depending on the construct design .

What expression vectors are most suitable for recombinant SecF production?

Selection of an appropriate expression vector depends on the research objectives:

Vector TypeFeaturesBest Used For
pMAL-c2XMBP fusion for solubility enhancementImproving solubility of difficult proteins
pET seriesT7 promoter, high expression levelsMaximum yield in E. coli
pFastBacBaculovirus expression system compatibleInsect cell expression
pSecTagMammalian expression with secretion signalNative-like folding studies

For rickettsial proteins, the pMAL-c2X vector has been successfully used to express fragments of OmpA and OmpB as fusion proteins with maltose-binding protein, improving solubility and enabling subsequent functional studies .

How can I assess the functional activity of purified recombinant SecF?

Functional assessment of SecF requires specialized assays that evaluate its role in protein translocation:

  • Reconstitution into proteoliposomes for translocation assays

  • ATPase activity assays (SecF works in complex with SecD and SecA, which has ATPase activity)

  • Binding assays with SecY/SecE components

  • In vitro translation/translocation systems using radiolabeled substrates

These functional assays can be complemented with structural characterization using techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes during the translocation cycle.

How can small regulatory RNAs impact SecF expression and function in Rickettsia conorii?

Rickettsia conorii has been found to possess a complex regulatory RNA landscape, including 4 riboswitches, 13 trans-acting (intergenic), and 22 cis-acting (antisense) small RNAs . While specific interactions between sRNAs and secF mRNA have not been directly reported, the identification of 502 genes as potential targets of Rc_sRs suggests potential post-transcriptional regulation of secF expression.

The methodology to investigate such interactions would include:

  • Bioinformatic prediction of sRNA-mRNA interactions using algorithms like IntaRNA or TargetRNA2

  • Experimental validation using techniques such as:

    • RNA electrophoretic mobility shift assays (EMSAs)

    • MS2-affinity purification coupled with RNA sequencing

    • In vivo reporter assays using fusions of secF 5' UTR to reporter genes

Northern hybridization could be used to confirm expression of novel sRNAs, as demonstrated for Rc_sR31, Rc_sR33, Rc_sR35, and Rc_sR42 .

What are the optimal methods for analyzing SecF membrane topology and integration?

As a membrane protein, SecF has a complex topology that can be analyzed through several complementary approaches:

  • Cysteine accessibility methods:

    • Introduction of cysteine residues at predicted loops

    • Selective labeling with membrane-permeable and impermeable reagents

    • Analysis by mass spectrometry

  • Protease protection assays:

    • Reconstitution into proteoliposomes

    • Limited proteolysis from both sides of the membrane

    • Analysis of fragments by western blotting

  • Fluorescence-based approaches:

    • Green fluorescent protein (GFP) fusions at predicted loops

    • Analysis of fluorescence quenching in different environments

These methodologies help establish the number of transmembrane segments and their orientation, critical for understanding SecF function in the protein translocation machinery.

How can I investigate structure-function relationships in SecF using recombinant protein variants?

Structure-function analysis of SecF requires systematic mutagenesis and functional testing:

Similar approaches have been used successfully for other rickettsial proteins, such as OmpA and OmpB, where specific fragments were expressed and tested for functionality. For example, researchers identified that OmpA 1350-1784, OmpB 801-1269, and OmpB 1227-1634 regions from truncated proteins were particularly useful as diagnostic antigens .

What size-exclusion chromatography (SEC) conditions are optimal for analyzing recombinant SecF?

SEC is a valuable technique for analyzing membrane proteins like SecF. Optimal conditions typically include:

ParameterRecommendationRationale
Column typeSuperose 6 or Superdex 200Appropriate resolution range for SecF
Mobile phasePBS + 0.05% DDM or equivalentMaintains protein solubility
Flow rate0.3-0.5 mL/minBalances resolution and analysis time
Temperature4-8°CMinimizes protein degradation
Sample concentration1-5 mg/mLPrevents column overloading

For complex biotherapeutic products, modifying SEC mobile-phase composition and running conditions can significantly impact separation quality . For membrane proteins like SecF, inclusion of appropriate detergents above their critical micelle concentration is essential to prevent aggregation.

How can I develop specific antibodies against recombinant Rickettsia conorii SecF?

Development of specific antibodies against SecF requires careful antigen design and validation:

  • Antigen design options:

    • Full-length recombinant SecF (challenging due to multiple transmembrane domains)

    • Soluble domains or peptides corresponding to extracellular/periplasmic regions

    • Fusion proteins containing SecF epitopes

  • Production approaches:

    • Polyclonal antibodies: Broader epitope recognition but potential cross-reactivity

    • Monoclonal antibodies: Higher specificity but more resource-intensive

    • Recombinant antibodies (e.g., scFv): Potentially reduced immunogenicity

  • Validation methods:

    • ELISA against purified SecF

    • Western blotting against recombinant SecF and native protein from R. conorii

    • Immunofluorescence microscopy to confirm cellular localization

For rickettsial proteins, researchers have successfully used recombinant fragments as immunogens. For example, with OmpA and OmpB proteins from R. conorii, specific regions were identified that showed 90-95% sensitivity and 100% specificity when used in diagnostic assays .

What bioinformatic tools and databases are most useful for analyzing SecF sequence and structure?

Bioinformatic analysis of SecF can provide valuable insights into function and evolution:

Tool/DatabaseApplicationURL
TMHMM/HMMTOPTransmembrane domain predictionwww.cbs.dtu.dk/services/TMHMM
Phyre2Protein structure predictionwww.sbg.bio.ic.ac.uk/phyre2
ConSurfEvolutionary conservation analysisconsurf.tau.ac.il
STRINGProtein-protein interaction networksstring-db.org
PfamProtein domain analysispfam.xfam.org

For rickettsial proteins, comparative analysis across species can reveal conserved functional domains. Similar approaches have been used for other membrane proteins to identify regions suitable for antibody development or drug targeting.

How can I improve the solubility and stability of recombinant SecF protein?

Membrane proteins like SecF present significant challenges for expression and purification. Several strategies can improve outcomes:

  • Fusion partners that enhance solubility:

    • Maltose-binding protein (MBP)

    • Thioredoxin (TrxA)

    • Glutathione S-transferase (GST)

    • SUMO protein

  • Expression conditions optimization:

    • Lower temperature (16-20°C)

    • Reduced inducer concentration

    • Specialized E. coli strains (C41/C43, Rosetta)

  • Buffer optimization for purification and storage:

    • Screening of detergents (DDM, LDAO, LMNG)

    • Addition of stabilizing agents (glycerol, specific lipids)

    • pH optimization based on theoretical isoelectric point

Similar approaches have proven successful for other challenging membrane proteins and could be adapted for SecF based on its specific properties.

How should I interpret conflicting results in SecF localization or functional studies?

Conflicting results in protein studies can arise from multiple factors:

  • Methodological differences:

    • Expression systems (E. coli vs. insect cells)

    • Purification methods affecting protein conformation

    • Assay conditions (buffer composition, temperature, pH)

  • Construct design variations:

    • Presence/absence of fusion tags

    • Different truncation points

    • Mutations in key residues

  • Data analysis approach:

    • Statistical methods used

    • Threshold definitions for positive/negative results

To resolve conflicts, design experiments that directly compare methods under identical conditions, use complementary techniques to address the same question, and critically evaluate all potential sources of variation in experimental design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.