Recombinant Rickettsia conorii Putative Na (+)/H (+) antiporter nhaA homolog (nhaA)

Shipped with Ice Packs
In Stock

Description

Recombinant Protein Production

The recombinant form of this protein is synthesized in Escherichia coli using a full-length gene construct (UniProt ID: Q92JA9) fused to an N-terminal His tag. Specifications include:

ParameterDetails
Expression HostE. coli
Amino Acid Length339 residues
Purity>85% (SDS-PAGE verified)
ApplicationsWestern blot (WB), ELISA
StorageTris-based buffer with 50% glycerol; stable at -20°C/-80°C .

The protein’s sequence (1-339aa) includes domains essential for ion transport, such as the conserved ion-binding cavity .

Research Applications

  • Vaccine Development: Recombinant Rickettsia proteins, such as the 198-kDa surface antigen of R. conorii, have been tested as vaccine candidates . Though not explicitly studied for NhaA, this highlights the potential utility of recombinant proteins in immunology.

  • Functional Complementation: Recombinant NhaA homologs are used in E. coli complementation assays to study ion transporter activity .

  • Diagnostic Tools: Proteins like RC_RS00820 (a recombinant R. conorii antigen) are employed in immunoassays for pathogen detection .

Comparative Analysis of Related Proteins

SpeciesProteinFunctionExpression System
Rickettsia conoriiPutative NhaA (Q92JA9)Na+^+/H+^+ antiportingE. coli
Rickettsia akariNhaA homolog (A8GQA2)Ion homeostasisE. coli
Escherichia coliNhaA (P25721)pH regulation, Na+^+ effluxNative

Future Directions

Further studies could explore:

  • Structural Resolution: Cryo-EM or X-ray crystallography to resolve the OF conformation of R. conorii NhaA .

  • Pathogenicity Links: Investigating whether NhaA contributes to R. conorii’s survival in host cells, akin to its role in V. cholerae .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
nhaA; RC1355; Putative Na(+/H(+ antiporter NhaA homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
nhaA
Target Protein Sequence
MVESGIHDTLCRAIIALFIPVNIKGEFNTSFKKLENLTRPFVNYFILPLFVFMNSGILLE YFAFKGICSNSILALIYGIIFGLFVGKQLGIMLFSYPFVKFKLCNLPSDTSWLKFYSIAI LGGIGFTLSLFIGSILRLRAAALQTL
Uniprot No.

Target Background

Database Links

KEGG: rco:RC1355

Protein Families
NhaA Na(+)/H(+) (TC 2.A.33) antiporter family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of the Na (+)/H (+) antiporter nhaA homolog in Rickettsia conorii?

The Na (+)/H (+) antiporter nhaA homolog in Rickettsia conorii functions similarly to its homologues in other bacteria as a critical component in maintaining ionic homeostasis within the bacterial cell. Based on studies of related antiporters, the protein is responsible for facilitating the exchange of Na+ and H+ ions across the bacterial membrane, which is essential for pH regulation, sodium extrusion, and osmotic balance . This function is particularly important for bacterial survival in challenging environments, including the intracellular environment of host cells during infection. The antiporter operates as a homodimer, with its monomeric structure comprised of 12 transmembrane helices packed in two domains: an interface domain that connects the two monomers and a core domain involved in ion translocation .

What diagnostic methods are used to detect Rickettsia conorii infections?

Detection of Rickettsia conorii infections typically employs a combination of molecular and serological methods:

  • Molecular Detection: Quantitative polymerase chain reaction (qPCR) targeting specific genes such as the 16S rDNA Rickettsia gene serves as a primary diagnostic tool . Confirmation and strain identification requires sequencing of multiple genes, including:

    • gltA (citrate synthase gene)

    • ompA (outer membrane protein A gene)

    • 17kDa protein gene

  • Serological Testing: ELISA methods targeting R. conorii IgM antibodies can identify active infections, with seroconversion demonstrated by a 3- to 4-fold increase in antibody titer in paired serum samples .

The diagnostic challenge lies in differentiating R. conorii infections from other febrile syndromes with similar presentations, such as Crimean-Congo hemorrhagic fever (CCHF), particularly in endemic regions .

How does the pH-dependent activity profile of Rickettsia conorii nhaA differ from other bacterial homologs?

While specific pH-activity data for R. conorii nhaA is not directly presented in the available literature, comparison with homologous antiporters reveals significant differences in pH response profiles among bacterial species. For instance, unlike E. coli NhaA, the S. Typhimurium antiporter maintains high transport activity at pH values above 8.5 . This differential pH response suggests species-specific adaptations potentially related to environmental niches or pathogenic lifestyles.

This pH-dependent activity variation likely reflects structural differences in the pH-sensing regions of the protein, potentially affecting:

  • Conformational changes during ion transport

  • Ion binding affinities at varying pH

  • Regulatory mechanisms controlling antiporter activity

For R. conorii, as an obligate intracellular pathogen, its nhaA homolog may be specifically adapted to function optimally within the pH range encountered in tick vectors and mammalian host cells throughout its complex life cycle.

What experimental approaches can evaluate the functional complementation capacity of Rickettsia conorii nhaA?

Functional complementation assays represent a powerful experimental approach to evaluate R. conorii nhaA activity. The methodology employed for homologous antiporters provides a framework that can be adapted:

  • Heterologous Expression System: The R. conorii nhaA gene can be cloned with a carboxy-terminal hexa-histidine tag in an expression vector (e.g., pTTQ18A1) for production in E. coli .

  • Complementation Analysis: The recombinant protein can be expressed in salt-sensitive Na+/H+ antiporter-deficient E. coli strains (e.g., EP432 lacking nhaA and nhaB genes) .

  • Growth Assays: Salt tolerance can be assessed using:

    • Micro-culture growth assays in media buffered at different pH values

    • Media supplemented with varying concentrations of NaCl or LiCl

    • Comparative growth analysis under basal vs. induced expression conditions

  • Protein Detection: Western-immunoblotting targeting the His-tag confirms expression of the recombinant antiporter .

This approach allows quantitative assessment of the antiporter's ability to restore salt tolerance in the deficient strain, providing functional insights without requiring direct transport measurements.

What are the molecular mechanisms underlying the differential temperature sensitivity of Rickettsia conorii in tick vectors?

The temperature sensitivity of R. conorii in its tick vectors involves complex host-pathogen interactions that affect pathogen transmission and environmental persistence. Research on R. conorii conorii-infected Rhipicephalus sanguineus ticks reveals that temperature significantly impacts survival of infected ticks:

  • Temperature Thresholds: R. conorii-infected ticks show poor tolerance to both low (4°C) and high (37°C) temperatures, particularly during eggs, larvae, and unfed nymph stages .

  • Differential Mortality: When exposed to temperature extremes for one month and then returned to optimal conditions (25°C), infected engorged nymphs experience higher mortality rates than non-infected counterparts .

  • Post-feeding Vulnerability: Infected adult ticks demonstrate high mortality when maintained at temperature extremes after feeding on hosts .

The molecular basis for this temperature sensitivity may involve:

  • Altered expression of heat/cold shock proteins in infected ticks

  • Metabolic burden imposed by rickettsial replication

  • Disruption of normal tick physiological processes by the pathogen

  • Temperature-dependent changes in bacterial protein function and stability

These findings suggest that infected quiescent ticks may not survive winter conditions, potentially explaining the low prevalence of infected R. sanguineus ticks in natural settings despite efficient transovarial transmission .

What molecular techniques are most effective for characterizing Rickettsia conorii nhaA expression and function?

Several complementary molecular techniques can effectively characterize R. conorii nhaA expression and function:

  • Gene Cloning and Recombinant Expression:

    • Vector selection with appropriate promoters and affinity tags

    • Optimization of codon usage for heterologous hosts

    • Expression in antiporter-deficient bacterial strains for complementation studies

  • Protein Purification and Characterization:

    • Detergent-based membrane protein extraction

    • Affinity chromatography utilizing His-tags

    • Size-exclusion chromatography for oligomeric state determination

    • Western blotting for expression confirmation

  • Functional Assays:

    • Salt sensitivity growth complementation assays

    • pH-dependent growth analysis

    • Direct transport measurements using ion-selective electrodes or fluorescent probes

    • Proteoliposome reconstitution for isolated system analysis

  • Structural Investigations:

    • Cryo-electron microscopy for structural determination

    • Site-directed mutagenesis of conserved residues

    • Computational modeling based on homologous antiporters

These methods should be applied in combination to build a comprehensive understanding of the antiporter's molecular characteristics and physiological role.

How can researchers establish reliable in vitro and in vivo models for studying Rickettsia conorii nhaA function?

Developing robust model systems for studying R. conorii nhaA requires addressing the challenges associated with obligate intracellular pathogens:

In Vitro Models:

  • Heterologous Expression Systems:

    • E. coli strains lacking endogenous Na+/H+ antiporters (e.g., EP432) for complementation studies

    • Expression in defined media with controlled ion composition

    • Inducible expression systems to regulate protein production

  • Cell Culture Models:

    • Infection of tick cell lines (e.g., ISE6) or mammalian cells

    • Assessment of bacterial growth under different pH and salt conditions

    • Gene silencing approaches to assess antiporter contribution to bacterial fitness

In Vivo Models:

  • Tick Vector Studies:

    • Laboratory-maintained Rhipicephalus sanguineus colonies

    • Controlled infection with wild-type and mutant R. conorii strains

    • Environmental parameter manipulation (temperature, humidity)

  • Mammalian Host Models:

    • Mouse or guinea pig infection models

    • Tissue distribution and bacterial load quantification

    • Assessment of antiporter contribution to virulence

Methodological Considerations:

  • Genetic manipulation techniques for R. conorii are challenging but essential

  • Controls must account for pleiotrophic effects of antiporter disruption

  • Integration of molecular and physiological readouts is critical

What are the critical parameters for optimizing recombinant expression of functional Rickettsia conorii nhaA?

Optimizing recombinant expression of functional R. conorii nhaA requires careful consideration of multiple parameters:

  • Expression System Selection:

    • E. coli BL21(DE3) or C43(DE3) strains optimized for membrane protein expression

    • Consideration of alternative hosts (e.g., insect cells) for complex membrane proteins

    • Assessment of constitutive versus inducible expression systems

  • Vector Design:

    • Promoter strength and regulation

    • Affinity tag placement (N- or C-terminal) to minimize functional interference

    • Inclusion of protease cleavage sites for tag removal

    • Codon optimization for the expression host

  • Culture Conditions:

    • Induction parameters (inducer concentration, temperature, timing)

    • Growth medium composition (salt concentration, pH buffering)

    • Scale-up considerations for protein yield optimization

  • Membrane Protein Solubilization:

    • Detergent screening (type, concentration, critical micelle concentration)

    • Lipid addition during solubilization

    • Buffer composition optimization (pH, salt, glycerol content)

  • Functional Assessment:

    • Growth complementation in antiporter-deficient strains

    • Transport activity measurements

    • Structural integrity evaluation

Systematic optimization of these parameters is essential for obtaining sufficient quantities of properly folded, functional protein for subsequent biochemical and structural studies.

How should researchers interpret sequence variations in nhaA homologs across Rickettsia species?

Interpretation of sequence variations in nhaA homologs requires a systematic analytical framework that contextualizes observed differences:

  • Evolutionary Conservation Analysis:

    • Core functional domains typically show higher conservation

    • Transmembrane regions often display higher conservation than loop regions

    • Key catalytic residues should be identified and compared across species

  • Structural Context Integration:

    • Mapping variations onto predicted structural models

    • Distinguishing surface-exposed vs. buried residue changes

    • Identifying variations in the interface and core domains

  • Functional Classification:

    • Conservative substitutions (maintaining physicochemical properties)

    • Non-conservative substitutions (potentially altering function)

    • Insertions/deletions affecting protein architecture

  • Ecological and Pathogenic Correlation:

    • Association of specific variants with host range

    • Correlation with vector specificity

    • Relationship to pathogenicity differences

For R. conorii specifically, sequence variations should be analyzed in the context of its lifestyle as an obligate intracellular pathogen transmitted by ticks, considering adaptations that might facilitate survival in these unique environments.

What statistical approaches are most appropriate for analyzing nhaA activity data across different experimental conditions?

Statistical analysis of nhaA activity data requires approaches that address the complexity of membrane protein function across varying conditions:

  • Multivariate Analysis:

    • Principal Component Analysis (PCA) to identify major factors influencing activity

    • Multiple regression models to quantify relationships between variables

    • ANOVA with post-hoc tests for comparing multiple experimental conditions

  • Dose-Response Modeling:

    • Hill equation fitting for ion concentration response data

    • EC50/IC50 determination for activators/inhibitors

    • Comparison of curve parameters across experimental conditions

  • Time-Series Analysis:

    • Kinetic parameter extraction (Vmax, Km) from transport data

    • Rate comparison across conditions using appropriate transformations

    • Modeling of adaptation/inactivation kinetics

  • Data Visualization:

    • Heat maps for multidimensional data representation

    • Response surface methodology for optimizing multiple parameters

    • Interaction plots for identifying synergistic effects

  • Reproducibility Assessment:

    • Calculation of coefficient of variation across replicates

    • Power analysis for experimental design optimization

    • Bootstrapping approaches for robust parameter estimation

When analyzing pH-dependent activity profiles, for instance, appropriate statistical methods can distinguish true biological differences from experimental variation and facilitate rigorous comparison between R. conorii nhaA and other bacterial homologs.

How does understanding Rickettsia conorii nhaA contribute to broader knowledge of bacterial pathogenesis?

The study of R. conorii nhaA provides critical insights into bacterial pathogenesis through several interconnected mechanisms:

  • Adaptation to Host Environments:

    • Maintenance of bacterial homeostasis during transition between tick vectors and mammalian hosts

    • Adaptation to varying intracellular pH conditions encountered during infection

    • Contribution to survival under osmotic stress conditions in different host tissues

  • Virulence Factor Characterization:

    • Role in supporting metabolic activities necessary for intracellular replication

    • Potential contribution to host cell manipulation during infection

    • Support for nutrient acquisition in nutrient-limited intracellular environments

  • Evolutionary Adaptations:

    • Comparative analysis with free-living bacterial antiporters reveals adaptations specific to obligate intracellular lifestyle

    • Identification of conserved mechanisms across pathogenic species

    • Understanding of host-specific adaptations in membrane transport systems

  • Therapeutic Target Potential:

    • Essential bacterial systems as targets for antimicrobial development

    • Structure-based drug design opportunities

    • Potential for broad-spectrum applications across related pathogens

The knowledge gained from R. conorii nhaA studies contributes to a fundamental understanding of how obligate intracellular bacteria maintain physiological homeostasis despite the challenges posed by host environments and defense mechanisms.

What are the most promising directions for future research on Rickettsia conorii nhaA?

Future research on R. conorii nhaA should focus on several high-priority areas:

  • Structural Biology:

    • High-resolution structural determination using cryo-electron microscopy or X-ray crystallography

    • Conformational dynamics studies using hydrogen-deuterium exchange or molecular dynamics simulations

    • Structure-function relationships through mutagenesis of key residues

  • Physiological Role:

    • In vivo contribution to bacterial fitness during infection

    • Temporal regulation during different infection stages

    • Interactions with other bacterial and host proteins

  • Comparative Biology:

    • Systematic comparison with other Rickettsia species with varying pathogenicity

    • Evolution of antiporter function in the context of host adaptation

    • Identification of species-specific regulatory mechanisms

  • Technological Innovations:

    • Development of genetic manipulation systems for direct study in R. conorii

    • Real-time imaging of ion transport in living bacteria

    • High-throughput screening methods for inhibitor discovery

  • Translational Applications:

    • Exploration as a potential diagnostic marker

    • Assessment as a vaccine component

    • Development of targeted antimicrobial strategies

These research directions would address critical knowledge gaps while leveraging advanced technologies to enhance our understanding of this important bacterial transport system.

Table 7.1: Comparative Analysis of nhaA Homologs Across Bacterial Species

SpeciespH OptimumTemperature SensitivityKey Structural FeaturesPhysiological Role
R. conoriiNot fully characterizedInfected ticks show poor survival at 4°C and 37°C Predicted 12 transmembrane helices in NhaA fold Ion homeostasis during intracellular infection
E. coliActivated above pH 6.5, decreased activity above pH 8.5 Relatively stable across temperature range12 transmembrane helices in NhaA fold, homodimer formation Primary Na+ extrusion system, pH homeostasis
S. TyphimuriumMaintains high activity above pH 8.5 Not fully characterizedSimilar to E. coli NhaA structureNa+ and Li+ stress resistance

Table 7.2: Detection Methods for Rickettsia conorii Infection

MethodTargetSensitivitySpecificityApplications
qPCR16S rDNAHighGenus-specificInitial screening
Gene SequencinggltA, ompA, 17kDaHighSpecies/strain-specificDefinitive identification
ELISAIgM antibodiesModerateMay cross-react with other rickettsial speciesSeroconversion monitoring
Western BlotSpecific proteinsHighVariable based on antigenConfirmation testing

Table 7.3: Temperature Effects on R. conorii-Infected Rhipicephalus sanguineus Ticks

Tick StageOptimal Temperature (25°C)Low Temperature (4°C)High Temperature (37°C)Key Observations
EggsNormal developmentPoor tolerance, high mortalityPoor tolerance, high mortalityTemperature extremes affect both infected and non-infected eggs
LarvaeNormal developmentPoor tolerancePoor toleranceSimilar effects in infected and non-infected specimens
Unfed NymphsNormal developmentPoor tolerancePoor toleranceSimilar effects in infected and non-infected specimens
Engorged NymphsNormal developmentHigher mortality in infected vs. non-infected when returned to 25°CHigher mortality in infected vs. non-infected when returned to 25°CInfection status creates differential temperature sensitivity
AdultsNormal developmentHigh post-feeding mortality in infected ticksHigh post-feeding mortality in infected ticksFeeding status interacts with temperature sensitivity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.