Recombinant Rickettsia conorii Putative sensor histidine kinase ntrY-like (RC0948)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics and Production

RC0948 is a full-length recombinant protein expressed in Escherichia coli with an N-terminal His-tag for purification. Key properties include:

PropertyDetails
SpeciesRickettsia conorii (strain Malish 7)
Gene NameRC0948
UniProt IDQ92H24
Length599 amino acids (1–599 aa)
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
FormLyophilized powder
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol (5–50% recommended)
Storage Conditions-20°C/-80°C (avoid freeze-thaw cycles)

Amino Acid Sequence:
MLSYLKQNLHSYFSSRVLIFTLATAAIIFACATFYVISLESKNFSTIIGFLLVDLAIFLI LGVVLTQKFFTKNNNNDSSKLQNRIVIAFSLVAAIPTIIVSVFSVYFFNLSVQAWFDKKI STVLDQSVIVAESYIAEHKLQLKETALAVAEDLSDMYYDLIHNPALFTKTLNTEAEMRSL DEAIVLNKSTNTIVANSYLSFSLSFATIPAHLIKKADLGELVEVKSDPTKIRMLIKLKEY NDVYLLVGRLVDNKIIDHVDATNGAAAEYNSLKNEIDNIQIKFSIMFIFIALLLLFVAIS FGVIFTAKIVKPIKKLVTATDNVKDGDLTVQVPENEVDKDEIGTLYVAFNRMIKQLSRQQ RDLVIAQRAMAWSDVAKKVAHEIKNPLTPILLASERLLKKFSPEIKERVEFENYLKMIIR HTNDIKNIVSEFVLFARLPAPKFTKSELVYLVKHIVEARKLLNDHILYKFESNVEQFDFM CDATQINQVMINLLKNAEESIEGRESGKIEVTIDVKDDFISVIVTDNGKGFPPELIGKAT ESYVTTSSKGMGVGLAIVKRIVEEHCGILDIANREAEGAIIDIKFDLKELDLKAKRLEM .

Enzymatic Activity

RC0948 operates in a two-component system with the response regulator RC0849. The reaction is:
ATP + protein L-histidineADP + protein N-phospho-L-histidine\text{ATP + protein L-histidine} \rightarrow \text{ADP + protein N-phospho-L-histidine}
This phosphorylation cascade enables Rickettsia to regulate gene expression in response to host-derived signals .

Diagnostic and Vaccine Development

  • Serological Assays: Recombinant RC0948 is used in ELISA kits to detect anti-Rickettsia antibodies, aiding in MSF diagnosis .

  • Antigenic Studies: The His-tagged protein facilitates purification for immunoassays, though its role as a vaccine candidate remains unexplored compared to other rickettsial surface proteins .

Plasmid Stability in Rickettsia

Studies on R. conorii transformed with plasmids (e.g., pRam18dRGA[AmTrCh]) demonstrate that extrachromosomal DNA does not impair bacterial viability or virulence, suggesting RC0948-expressing strains could serve as tools for genetic manipulation .

Comparative Analysis with Homologs

SpeciesHomolog IDSequence IdentityFunctionSource
Rickettsia felisRF_042725.48%Putative sensor histidine kinase
Rickettsia typhiRT060324.84%Two-component sensor histidine kinase
Rickettsia belliiRBE_047024.84%Putative sensor histidine kinase

RC0948 shows low sequence identity with homologs in non-Rickettsia species, highlighting its niche in Rickettsia pathobiology .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
RC0948; Putative sensor histidine kinase NtrY-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-599
Protein Length
full length protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
RC0948
Target Protein Sequence
MLSYLKQNLHSYFSSRVLIFTLATAAIIFACATFYVISLESKNFSTIIGFLLVDLAIFLI LGVVLTQKFFTKNNNNDSSKLQNRIVIAFSLVAAIPTIIVSVFSVYFFNLSVQAWFDKKI STVLDQSVIVAESYIAEHKLQLKETALAVAEDLSDMYYDLIHNPALFTKTLNTEAEMRSL DEAIVLNKSTNTIVANSYLSFSLSFATIPAHLIKKADLGELVEVKSDPTKIRMLIKLKEY NDVYLLVGRLVDNKIIDHVDATNGAAAEYNSLKNEIDNIQIKFSIMFIFIALLLLFVAIS FGVIFTAKIVKPIKKLVTATDNVKDGDLTVQVPENEVDKDEIGTLYVAFNRMIKQLSRQQ RDLVIAQRAMAWSDVAKKVAHEIKNPLTPILLASERLLKKFSPEIKERVEFENYLKMIIR HTNDIKNIVSEFVLFARLPAPKFTKSELVYLVKHIVEARKLLNDHILYKFESNVEQFDFM CDATQINQVMINLLKNAEESIEGRESGKIEVTIDVKDDFISVIVTDNGKGFPPELIGKAT ESYVTTSSKGMGVGLAIVKRIVEEHCGILDIANREAEGAIIDIKFDLKELDLKAKRLEM
Uniprot No.

Target Background

Function
A member of the two-component regulatory system RC0948/RC0849.
Database Links

KEGG: rco:RC0948

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Rickettsia conorii Putative sensor histidine kinase ntrY-like (RC0948)?

Recombinant Rickettsia conorii Putative sensor histidine kinase ntrY-like (RC0948) is a bacterial protein from Rickettsia conorii strain ATCC VR-613 / Malish 7 with the UniProt accession number Q92H24. It functions as a putative sensor histidine kinase (EC 2.7.13.3) within bacterial two-component signaling systems. The full-length protein spans the expression region 1-599 and is typically produced recombinantly for research purposes in a stable Tris-based buffer containing 50% glycerol to maintain protein integrity .

To study this protein, researchers should begin with bioinformatic analysis of the primary sequence to identify functional domains. Methods include sequence alignment with known histidine kinases, prediction of transmembrane regions, and identification of conserved catalytic motifs. For experimental analysis, purified recombinant protein can be used for enzymatic assays, structural studies, or interaction analyses with potential response regulators.

How do two-component signaling systems involving histidine kinases function in bacterial pathogenesis?

Two-component signaling systems (TCSs) involving histidine kinases play crucial roles in bacterial pathogenesis by sensing environmental changes and triggering appropriate cellular responses. The methodology for studying these systems begins with identifying both components: the sensor histidine kinase (like RC0948) and its cognate response regulator.

Typical TCS signaling occurs through a phosphorelay mechanism where:

  • The sensor domain detects specific environmental stimuli

  • Autophosphorylation occurs at a conserved histidine residue

  • The phosphoryl group transfers to an aspartate residue in the response regulator

  • The phosphorylated response regulator mediates changes in gene expression

In the case of hybrid sensor kinases like RpfC in Xanthomonas campestris (similar to RC0948), three conserved amino acid residues are essential for phosphorelay: His(198) in the histidine kinase domain, Asp(512) in the receiver domain, and His(657) in the histidine phosphotransfer domain . This multi-step phosphorylation cascade allows for more precise regulation of virulence factors and adaptation to host environments.

What storage and handling protocols should be followed for Recombinant Rickettsia conorii Putative sensor histidine kinase?

For optimal research outcomes when working with Recombinant Rickettsia conorii Putative sensor histidine kinase ntrY-like (RC0948), follow these methodological storage and handling protocols:

  • Long-term storage: Store the protein at -20°C, or preferably at -80°C for extended periods to maintain activity.

  • Working aliquots: To avoid repeated freeze-thaw cycles, prepare smaller working aliquots and store at 4°C for up to one week.

  • Buffer composition: The protein is typically maintained in a Tris-based buffer with 50% glycerol, optimized specifically for RC0948 stability .

  • Freeze-thaw cycles: Minimize repeated freezing and thawing as this can significantly compromise protein activity and structural integrity.

  • Temperature control during experiments: When conducting experiments, maintain the protein on ice when not in use and work at controlled temperatures appropriate for the specific assay.

Additionally, before using in experiments, confirm protein quality through methods such as SDS-PAGE to verify purity and Western blotting to confirm identity.

How can dual signaling mechanisms of sensor histidine kinases be experimentally validated?

Based on research with similar hybrid sensor kinases like RpfC, dual signaling mechanisms can be validated through a systematic experimental approach that separates phosphorelay-dependent and protein-protein interaction mechanisms. The methodology involves:

  • Site-directed mutagenesis: Create precise mutations at conserved phosphorelay residues (histidine in the kinase domain, aspartate in the receiver domain, and histidine in the phosphotransfer domain). For RC0948, this would involve targeting residues analogous to His(198), Asp(512), and His(657) identified in RpfC .

  • Domain deletion analysis: Generate constructs expressing individual domains to determine which regions are sufficient for specific functions. For RC0948, examine the receiver domain independently, as research with RpfC showed this domain alone was sufficient for certain regulatory functions .

  • Alanine scanning mutagenesis: Systematically replace amino acid residues with alanine to identify specific residues involved in protein-protein interactions beyond phosphorelay mechanisms.

  • Protein-protein interaction assays:

    • Co-immunoprecipitation to identify protein binding partners

    • Far-Western blot analysis to confirm direct interactions

    • Yeast two-hybrid or bacterial two-hybrid systems for in vivo interaction studies

    • Fluorescence resonance energy transfer (FRET) for dynamic interaction analysis

  • Functional assays: Compare the effects of mutations on different signaling outputs to distinguish phosphorelay-dependent and independent functions.

A comprehensive experimental design would include both in vitro biochemical assays and in vivo functional studies to validate the dual signaling mechanisms.

What are the comparative differences between ntrY-like sensor histidine kinases across bacterial species?

To methodically analyze comparative differences between ntrY-like sensor histidine kinases across bacterial species, researchers should employ a multi-level analysis approach:

  • Sequence-level comparison:

    • Perform multiple sequence alignment of ntrY-like proteins from diverse bacterial species

    • Calculate sequence identity and similarity percentages

    • Generate phylogenetic trees to visualize evolutionary relationships

    • Identify conserved domains and species-specific sequence variations

  • Structural comparison:

    • Use homology modeling to predict structures when crystallographic data is unavailable

    • Compare domain organization and tertiary structure predictions

    • Analyze sensory domains for species-specific adaptations

    • Identify structural features that might correlate with habitat or pathogenicity

  • Functional comparison:

    • Examine substrate specificity and enzymatic kinetics

    • Compare phosphotransfer efficiency to cognate response regulators

    • Analyze sensory mechanisms and signal recognition specificities

    • Study regulation of downstream genes and pathways

FeatureRC0948 (R. conorii)RpfC (X. campestris)Other ntrY-like kinases
DomainsSensor, histidine kinase, receiver domainsHK, receiver, HPT domainsVariable domain structures
SignalingPutative dual signaling mechanismConfirmed dual signaling (phosphorelay and protein-protein interaction)Often single phosphorelay mechanism
ConservationSpecific to Rickettsia speciesFound in Xanthomonas speciesDiverse distribution
RoleUnder investigationVirulence regulation and quorum sensingVariable environmental sensing

This comparative approach reveals evolutionary adaptations of these signaling systems to various ecological niches and pathogenic lifestyles.

How can researchers optimize phosphorelay activity assays for sensor histidine kinases?

Optimizing phosphorelay activity assays for sensor histidine kinases like RC0948 requires careful consideration of multiple parameters. The methodological approach should include:

  • Protein preparation optimization:

    • Express the full-length protein or specific domains with appropriate tags for purification

    • Verify protein folding using circular dichroism spectroscopy

    • Confirm activity retention after purification with preliminary assays

  • Phosphorylation assay design:

    • Utilize γ-³²P-ATP for radiolabeled phosphorylation assays to detect autophosphorylation

    • Develop non-radioactive alternatives using phospho-specific antibodies or Phos-tag SDS-PAGE

    • Establish time-course experiments to capture kinetics of phosphorylation and dephosphorylation

  • Buffer optimization matrix:

    • Test multiple buffer systems (HEPES, Tris, Phosphate) at different pH values (6.5-8.0)

    • Vary divalent cation concentrations (Mg²⁺, Mn²⁺, Ca²⁺) as cofactors

    • Adjust ionic strength with different concentrations of NaCl or KCl

    • Include stabilizing agents (glycerol, reducing agents) as needed

  • Temperature and reaction time optimization:

    • Test temperature range relevant to physiological conditions (25-37°C)

    • Establish optimal reaction times through time-course experiments

  • Phosphotransfer to response regulator:

    • Include putative cognate response regulator in reactions

    • Measure phosphotransfer efficiency under various conditions

    • Determine specificity using non-cognate response regulators as controls

Researchers should develop a systematic grid of conditions and use statistical approaches like factorial design to efficiently identify optimal assay conditions while minimizing the number of experiments required.

How should researchers design experiments to study the function of RC0948 in Rickettsia conorii pathogenesis?

To design robust experiments investigating RC0948's role in Rickettsia conorii pathogenesis, researchers should follow a structured experimental design process:

  • Define variables clearly :

    • Independent variable: RC0948 expression/activity levels (wild-type, knockout, overexpression, or specific domain mutations)

    • Dependent variables: Measurable indicators of pathogenesis (invasion efficiency, intracellular growth, cytopathic effects, virulence in animal models)

    • Control variables: Growth conditions, cell lines, infection protocols

  • Formulate specific, testable hypotheses , such as:

    • "Deletion of RC0948 will reduce R. conorii invasion of endothelial cells by >50% compared to wild-type."

    • "Mutation of the conserved histidine residue in RC0948 will attenuate virulence in a mouse model of infection."

  • Design experimental treatments :

    • Generate RC0948 knockout strains using appropriate genetic tools

    • Create point mutations in conserved domains (similar to His-198, Asp-512, His-657 identified in RpfC)

    • Develop complemented strains to verify phenotypes

    • Use pharmacological inhibitors of histidine kinase activity as alternative approaches

  • Plan appropriate controls:

    • Wild-type R. conorii strain

    • Complemented mutant strains

    • Mutations in non-essential residues

    • Treatments with inactive inhibitor analogs

  • Select appropriate model systems:

    • In vitro: Human endothelial cell infection models

    • Ex vivo: Perfused tissue models

    • In vivo: Animal models of Mediterranean spotted fever

  • Plan precise measurement methods:

    • Quantitative PCR for bacterial load

    • Immunofluorescence microscopy for localization

    • Transcriptomics to assess downstream effects

    • Phosphoproteomic analysis to identify phosphorylation targets

This experimental design approach will generate reliable data on RC0948's role in pathogenesis while controlling for confounding variables.

What are the best approaches for studying protein-protein interactions involving RC0948?

For studying protein-protein interactions involving RC0948, researchers should employ complementary techniques that provide different levels of evidence and address various aspects of interaction dynamics. A methodological approach includes:

  • In silico prediction of interaction partners:

    • Use computational tools to predict potential binding partners based on:

      • Known interactions of homologous proteins

      • Structural modeling and docking simulations

      • Analysis of genomic context and co-expression patterns

  • Affinity-based methods for identifying unknown partners:

    • Pull-down assays: Express RC0948 with affinity tags (His, GST, MBP) to capture interacting proteins

    • Co-immunoprecipitation: Use specific antibodies against RC0948 to precipitate protein complexes

    • Proximity labeling: Employ BioID or APEX2 fusion proteins to label proximal proteins in the cellular context

    • Yeast two-hybrid or bacterial two-hybrid screening: Systematically test for interactions with libraries of potential partners

  • Direct interaction confirmation methods:

    • Far-Western blotting: Probe immobilized proteins with purified RC0948 to detect direct interactions

    • Surface plasmon resonance (SPR): Measure real-time binding kinetics and affinity constants

    • Isothermal titration calorimetry (ITC): Determine thermodynamic parameters of binding

    • Microscale thermophoresis (MST): Measure interactions in solution with minimal protein consumption

  • Structural analysis of complexes:

    • X-ray crystallography of co-crystallized complexes

    • Cryo-electron microscopy for larger assemblies

    • NMR spectroscopy for dynamic interaction mapping

    • Hydrogen-deuterium exchange mass spectrometry to identify interaction interfaces

  • Functional validation of interactions:

    • Mutational analysis of predicted interaction interfaces

    • Competition assays with peptides derived from interaction domains

    • In vivo co-localization studies using fluorescent protein fusions

By combining multiple approaches, researchers can build strong evidence for physiologically relevant protein-protein interactions involving RC0948 and distinguish between direct and indirect interactions.

How can mediating and moderating variables be incorporated in studies of RC0948 function?

When studying RC0948 function, incorporating mediating and moderating variables into experimental design is crucial for revealing complex regulatory relationships. A methodological framework includes:

  • Identify potential mediating variables :

    • Phosphorylation intermediates in the signaling cascade

    • Second messengers generated downstream of RC0948 activation

    • Transcription factors regulated by RC0948 signaling

    • Example mediating pathway: RC0948 activation → phosphorylation of response regulator → altered gene expression → virulence factor production

  • Identify potential moderating variables :

    • Environmental conditions (temperature, pH, nutrient availability)

    • Host cell types and states

    • Presence of other bacterial signaling molecules

    • Co-infecting pathogens or microbiome interactions

  • Experimental design considerations:

    • Use factorial designs to systematically vary moderating variables

    • Include measurements of both mediating variables and final outcomes

    • Employ time-course experiments to establish temporal sequences

  • Statistical analysis approaches:

    • Mediation analysis to quantify indirect effects

    • Moderation analysis to identify interaction effects

    • Path analysis for complex signaling networks

    • Structural equation modeling for comprehensive pathway analysis

Type of VariableExamples for RC0948Measurement MethodsAnalysis Approach
IndependentRC0948 expression/activityqPCR, Western blot, activity assaysManipulation in experimental design
MediatingResponse regulator phosphorylationPhos-tag SDS-PAGE, phospho-specific antibodiesMediation analysis, path analysis
ModeratingTemperature, pH, host cell typeControlled experimental conditionsModeration analysis, interaction terms
DependentVirulence, adhesion, invasionInfection assays, animal modelsPrimary outcome measures

By explicitly incorporating mediating and moderating variables, researchers can develop more comprehensive models of how RC0948 functions within complex bacterial signaling networks and host-pathogen interactions.

What statistical approaches are most appropriate for analyzing enzymatic activity data for RC0948?

  • Descriptive statistics and data visualization:

    • Calculate means, standard deviations, and confidence intervals

    • Create time-course curves for autophosphorylation and phosphotransfer reactions

    • Plot Michaelis-Menten curves for kinetic parameters

    • Use box plots and violin plots to visualize distributions of activity across conditions

  • Parametric statistical tests (when assumptions are met):

    • t-tests: Compare activity between two conditions (e.g., wild-type vs. mutant)

    • ANOVA: Compare activity across multiple conditions with post-hoc tests (Tukey's HSD, Bonferroni)

    • Repeated measures ANOVA: For time-course experiments with the same protein preparations

    • Regression analysis: Determine relationships between variables (e.g., substrate concentration vs. reaction velocity)

  • Non-parametric alternatives (when data violates assumptions):

    • Mann-Whitney U test (alternative to t-test)

    • Kruskal-Wallis test (alternative to one-way ANOVA)

    • Friedman test (alternative to repeated measures ANOVA)

  • Specialized analyses for enzyme kinetics:

    • Nonlinear regression for fitting Michaelis-Menten equations

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations

    • Global curve fitting for complex kinetic models

    • Statistical comparison of derived parameters (Km, Vmax, kcat, kcat/Km)

  • Multiple testing correction:

    • Bonferroni correction for family-wise error rate

    • Benjamini-Hochberg procedure for false discovery rate

    • Sequential Bonferroni (Holm) correction for balanced approach

  • Sample size and power considerations:

    • Conduct power analysis to determine minimum sample sizes

    • Report effect sizes alongside p-values

    • Consider using confidence intervals rather than just p-values

For publication-quality analysis, researchers should justify their statistical approach, verify that assumptions are met, and use appropriate specialized software for enzyme kinetic data analysis.

How should researchers interpret contradictory results in studies of RC0948 function?

When faced with contradictory results in studies of RC0948 function, researchers should adopt a systematic approach to interpretation and resolution. The methodological framework includes:

  • Systematic evaluation of methodological differences:

    • Examine protein preparation methods (full-length vs. truncated constructs)

    • Compare experimental conditions (buffers, temperature, pH, ionic strength)

    • Assess cell models or systems used (in vitro vs. cell-based vs. in vivo)

    • Evaluate measurement techniques and their sensitivities

    • Review genetic backgrounds of bacterial strains used

  • Consider biological explanations for discrepancies:

    • Dual signaling functions: Like RpfC, RC0948 may have phosphorelay-dependent and independent functions that can be differentially affected by experimental conditions

    • Context-dependent activities: Function may vary based on cellular localization or interaction partners

    • Strain-specific differences: Genetic background could influence results

    • Adaptive responses: Compensatory mechanisms may mask phenotypes in certain conditions

  • Technical approach to resolution:

    • Replicate both contradictory methods in parallel

    • Systematically vary conditions to identify factors causing divergence

    • Employ orthogonal techniques to validate findings

    • Collaborate with labs reporting contradictory results

  • Data integration strategies:

    • Meta-analysis of available data when multiple studies exist

    • Bayesian approaches to weight evidence from different studies

    • Develop comprehensive models that can account for seemingly contradictory observations

    • Consider feedback loops and non-linear relationships in signaling networks

  • Reporting recommendations:

    • Transparently document all experimental conditions as would be done in clinical study reports

    • Provide complete details on protein constructs and expression systems

    • Report negative and inconclusive results alongside positive findings

    • Acknowledge limitations and alternative interpretations of data

This methodological approach transforms contradictory results from a scientific problem into an opportunity for deeper insight into the complex and context-dependent functions of RC0948.

How can researchers effectively document and report histidine kinase experiments for reproducibility?

For maximizing reproducibility in histidine kinase experiments with RC0948, researchers should adopt comprehensive documentation practices similar to those used in clinical study reports . A methodological framework includes:

  • Detailed documentation of materials:

    • Provide complete amino acid sequences of protein constructs

    • Specify expression systems, tags, and purification methods

    • Document source and lot numbers of key reagents

    • Include detailed buffer compositions with precise pH values

  • Comprehensive methods reporting:

    • Create detailed protocols with specific parameters (temperatures, incubation times, concentrations)

    • Document equipment models and settings

    • Provide step-by-step procedures that could be reproduced by other laboratories

    • Include validation steps for critical reagents

  • Structured experimental design documentation:

    • Clearly state hypotheses and objectives

    • Define all variables (independent, dependent, controlled)

    • Document randomization procedures and blinding methods when applicable

    • Provide sample size calculations and justifications

  • Complete results reporting:

    • Include all relevant data points, not just summaries

    • Report both positive and negative outcomes

    • Document unexpected observations

    • Provide raw data in supplementary materials or repositories

  • Implementation of standardized reporting frameworks:

    • Adapt clinical study report structures for basic research :

      • Include detailed synopses (median 5 pages in CSRs)

      • Provide comprehensive protocols (median 62 pages in CSRs)

      • Document statistical analysis plans (median 15 pages in CSRs)

      • Consider sharing equivalent of case report forms for complex experiments

  • Data sharing practices:

    • Deposit raw data in appropriate repositories

    • Share detailed protocols on platforms like protocols.io

    • Provide sequence data in standard databases

    • Make code for analysis publicly available

By implementing these documentation practices, researchers studying RC0948 and other histidine kinases can enhance reproducibility, facilitate meta-analyses, and accelerate scientific progress through more effective knowledge sharing.

What are the most sensitive methods for detecting phosphorylation states of histidine kinases like RC0948?

Detecting phosphorylation states of histidine kinases presents unique challenges due to the labile nature of the phosphohistidine bond. For RC0948 research, a methodological hierarchy of techniques includes:

  • Radiolabeling techniques (highest sensitivity):

    • γ-³²P-ATP labeling: The gold standard for detecting autophosphorylation

      • Methodology: Incubate purified RC0948 with γ-³²P-ATP, stop reaction with SDS loading buffer at pH 8.8 (avoid acidic conditions), separate by SDS-PAGE, and detect by autoradiography

      • Advantage: Directly visualizes phosphorylation events

      • Limitation: Requires radioisotope handling facilities

  • Phosphohistidine-specific antibodies:

    • Monoclonal antibodies: Recently developed phosphohistidine-specific antibodies

      • Methodology: Western blotting with specialized transfer conditions and rapid processing to minimize phosphohistidine hydrolysis

      • Advantage: No radioisotopes required

      • Limitation: May have cross-reactivity issues; limited commercial availability

  • Mass spectrometry approaches:

    • LC-MS/MS with neutral loss scanning: Specialized methods for phosphohistidine

      • Methodology: Rapid protein digestion under non-acidic conditions, specialized chromatography, and mass spectrometry protocols optimized for phosphohistidine

      • Advantage: Can identify specific phosphorylation sites

      • Limitation: Requires specialized expertise and equipment

  • Gel-based methods:

    • Phos-tag SDS-PAGE: Acrylamide-pendant Phos-tag molecules retard phosphorylated proteins

      • Methodology: Incorporate Phos-tag reagent in SDS-PAGE gels to separate phosphorylated and non-phosphorylated forms

      • Advantage: Simple implementation in standard laboratories

      • Limitation: Less specific than other methods

  • Chemical biology approaches:

    • Thiophosphorylation: Use ATPγS for thiophosphorylation, which creates more stable bonds

      • Methodology: React kinase with ATPγS, then alkylate resulting thiophosphate for detection

      • Advantage: More stable modification for downstream analysis

      • Limitation: May alter kinase activity or specificity

  • Real-time assays:

    • Fluorescence-based reporters: FRET-based sensors for conformational changes

      • Methodology: Engineer fluorescent protein pairs into RC0948 domains that undergo conformational changes upon phosphorylation

      • Advantage: Enables real-time monitoring in living cells

      • Limitation: Requires protein engineering and validation

Each method presents trade-offs between sensitivity, specificity, technical difficulty, and physiological relevance. Combining multiple approaches provides the most robust characterization of RC0948 phosphorylation states.

How can researchers effectively analyze the impact of RC0948 mutations on protein structure and function?

To comprehensively analyze how mutations affect RC0948 structure and function, researchers should employ a multi-dimensional approach that integrates computational prediction, structural analysis, and functional characterization. A methodological framework includes:

Mutation TypeStructural Analysis MethodsFunctional Analysis Methods
Catalytic site mutationsX-ray crystallography, MD simulationsAutophosphorylation assays, phosphotransfer kinetics
Sensor domain mutationsHDX-MS, SAXS, ligand binding assaysSignal response assays, ligand binding kinetics
Interface mutationsCo-crystallization, crosslinkingCo-immunoprecipitation, SPR, Y2H
Transmembrane mutationsNMR in membrane mimetics, accessibility studiesLocalization studies, signal transduction efficiency

This comprehensive approach allows researchers to connect structural perturbations to functional consequences, providing mechanistic insights into RC0948 function.

What are the best practices for preparing and purifying recombinant histidine kinases for structural studies?

Preparing recombinant histidine kinases like RC0948 for structural studies requires specialized approaches to overcome challenges with membrane proteins and maintain functional integrity. A methodological protocol includes:

  • Construct design optimization:

    • Domain analysis: Carefully analyze domain boundaries using bioinformatics

    • Expression construct strategies:

      • Full-length protein (challenging but physiologically relevant)

      • Cytoplasmic domains only (higher yield but lacks membrane context)

      • Individual domains (highest yield but loses interdomain interactions)

    • Fusion tags: Consider MBP, SUMO, or TrxA to enhance solubility

    • Affinity tags: His6, GST, or combinations for purification

    • Cleavage sites: Include protease sites for tag removal

  • Expression system selection:

    • E. coli: BL21(DE3), C41/C43 for membrane proteins, ArcticExpress for lower temperature

    • Insect cells: For improved folding of complex domains

    • Cell-free systems: For toxic proteins

    • Expression conditions:

      • Temperature: Often 16-20°C for improved folding

      • Induction: Low IPTG concentrations (0.1-0.5 mM)

      • Media: Consider auto-induction or enriched media

  • Solubilization and extraction strategies:

    • For full-length membrane proteins:

      • Detergent screening (DDM, LMNG, CHAPS)

      • Nanodiscs or amphipols for detergent-free environments

      • Lipid-based systems for native-like environments

    • For cytoplasmic domains:

      • Standard lysis buffers with protease inhibitors

      • Consider stabilizing additives (glycerol, reducing agents)

  • Multi-step purification protocol:

    • Initial capture: Affinity chromatography (IMAC, GST)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

    • Quality control checkpoints:

      • SDS-PAGE for purity assessment

      • Western blot for identity confirmation

      • Dynamic light scattering for homogeneity

      • Activity assays for functional verification

  • Buffer optimization for structural studies:

    • Crystallography-specific considerations:

      • Concentrated protein (5-15 mg/ml)

      • Minimal buffer components

      • Consider including stabilizing ligands

    • NMR-specific considerations:

      • Isotopic labeling (¹⁵N, ¹³C, ²H)

      • Low-salt buffers

    • Cryo-EM considerations:

      • Detergent selection and concentration

      • Grid preparation optimization

  • Stability assessment and enhancement:

    • Thermal shift assays: Identify stabilizing conditions

    • Limited proteolysis: Identify stable domains

    • Additive screening: Find stabilizing small molecules

    • Engineering approaches: Consider thermostabilizing mutations

By following these methodological best practices, researchers can improve their chances of obtaining high-quality RC0948 protein preparations suitable for structural studies, which remain one of the most challenging aspects of histidine kinase research.

What are the emerging technologies most likely to advance research on sensor histidine kinases like RC0948?

Research on sensor histidine kinases like RC0948 is poised to be transformed by several emerging technologies that address current methodological limitations. A forward-looking analysis includes:

  • Cryo-electron microscopy advancements:

    • Single particle analysis: Enabling structure determination of full-length kinases without crystallization

    • Tomography: Visualizing histidine kinases in their native membrane environment

    • Time-resolved cryo-EM: Capturing different conformational states during signaling

    • Methodological impact: Will reveal dynamic structural changes currently difficult to capture with X-ray crystallography

  • Advanced mass spectrometry techniques:

    • Crosslinking mass spectrometry (XL-MS): Mapping protein-protein interactions in complex signaling networks

    • Native mass spectrometry: Analyzing intact complexes and conformational states

    • Improved phosphohistidine detection: New chemical approaches for stabilizing and detecting phosphohistidine

    • Methodological impact: Will enable comprehensive mapping of signaling networks and detect transient modifications

  • Integrative structural biology approaches:

    • Combined methods: Integrating data from X-ray, NMR, cryo-EM, SAXS, and computational modeling

    • In-cell structural biology: Determining structures in native cellular environments

    • Methodological impact: Will provide more physiologically relevant structural insights

  • Synthetic biology and genetic tools:

    • CRISPR-based technologies: Precise genome editing in difficult-to-manipulate organisms like Rickettsia

    • Optogenetic control: Light-controlled activation/inhibition of kinase activity

    • Biosensors: Genetically encoded sensors to monitor kinase activity in real-time

    • Methodological impact: Will enable unprecedented control and monitoring of signaling pathways

  • Artificial intelligence applications:

    • AlphaFold and similar tools: Accurate prediction of protein structures and complexes

    • Machine learning for functional prediction: Identifying functional relationships from large datasets

    • Automated experimental design: Optimizing experimental conditions using AI

    • Methodological impact: Will accelerate hypothesis generation and testing cycles

  • Microfluidic and single-cell technologies:

    • Single-cell analysis: Examining cell-to-cell variability in signaling responses

    • Microfluidic devices: High-throughput screening of conditions and mutants

    • Methodological impact: Will reveal heterogeneity in responses previously masked in population studies

These emerging technologies will collectively advance our understanding of RC0948 and similar histidine kinases by providing new methodological approaches to overcome current technical barriers in structural, functional, and systems-level analyses.

How can knowledge of RC0948 from Rickettsia conorii contribute to broader understanding of bacterial signaling systems?

Research on RC0948 from Rickettsia conorii can provide unique insights that contribute to broader understanding of bacterial signaling systems through several methodological pathways:

  • Comparative analysis with canonical systems:

    • Rickettsia species are obligate intracellular pathogens with streamlined genomes

    • Methodological approach: Compare RC0948-mediated signaling with homologous systems in free-living bacteria to identify core conserved mechanisms versus adaptations for intracellular lifestyle

    • Broader impact: Reveals which signaling components are essential across diverse bacterial lifestyles

  • Evolution of signaling complexity:

    • Rickettsia genomes show evidence of reductive evolution

    • Methodological approach: Analyze RC0948 signaling pathway complexity relative to environmental bacteria with larger genomes and more TCS components

    • Broader impact: Provides insights into the minimal signaling requirements for different ecological niches

  • Host-pathogen interface signaling:

    • RC0948 likely responds to host-derived signals during infection

    • Methodological approach: Identify host factors that trigger RC0948 signaling and compare with other intracellular pathogens

    • Broader impact: Reveals common host cues sensed by diverse bacterial pathogens

  • Novel signaling mechanisms:

    • Like RpfC, RC0948 may employ dual signaling mechanisms combining phosphorelay and protein-protein interactions

    • Methodological approach: Characterize non-canonical signaling mechanisms and compare with other systems

    • Broader impact: Expands the paradigm of bacterial signal transduction beyond classical models

  • Specialized adaptation of conserved domains:

    • RC0948 contains conserved domains adapted to Rickettsia's unique lifestyle

    • Methodological approach: Structure-function analysis of specialized adaptations

    • Broader impact: Provides insights into domain evolution and functional adaptation

  • Cross-talk with other signaling pathways:

    • RC0948 likely integrates with other networks in a streamlined signaling system

    • Methodological approach: Map interactions between RC0948 and other pathways

    • Broader impact: Improves models of bacterial signaling networks and integration

By studying RC0948 as a model histidine kinase in an obligate intracellular pathogen, researchers can gain insights that complement studies of model organisms, ultimately building a more comprehensive understanding of bacterial signaling across diverse species and lifestyles.

What are the most promising therapeutic applications targeting bacterial histidine kinases like RC0948?

Histidine kinases like RC0948 represent promising antimicrobial drug targets due to their essential roles in bacterial signaling and absence in mammals. A methodological analysis of therapeutic applications includes:

  • Direct inhibitor development approach:

    • ATP-competitive inhibitors:

      • Methodology: Target the conserved ATP-binding pocket

      • Advantages: Well-established paradigm from protein kinase inhibitors

      • Challenges: Achieving selectivity among bacterial kinases

      • Current status: Several compounds in preclinical development

    • Response regulator binding site inhibitors:

      • Methodology: Block interaction between histidine kinase and response regulator

      • Advantages: Higher specificity due to unique protein-protein interfaces

      • Challenges: Difficult to target protein-protein interactions

      • Current status: Early discovery phase

    • Sensor domain modulators:

      • Methodology: Target the sensory domain to lock kinase in inactive conformation

      • Advantages: Highest specificity for individual kinases

      • Challenges: Requires detailed structural knowledge

      • Current status: Conceptual stage for most kinases

  • Structure-based drug design methodology:

    • Virtual screening against known structures

    • Fragment-based approaches to develop novel scaffolds

    • Rational design based on phosphorylation mechanisms

    • Current status: Limited by available structural data for RC0948

  • Phenotypic screening approach:

    • High-throughput screening against Rickettsia growth

    • Target validation using resistant mutant generation and sequencing

    • Advantages: Identifies compounds with cellular activity

    • Challenges: Difficult to culture Rickettsia for screening

    • Current status: Few large-scale screens specifically for Rickettsia

  • Combination therapy strategies:

    • Dual targeting of multiple histidine kinases

    • Combining histidine kinase inhibitors with traditional antibiotics

    • Current status: Promising approach to reduce resistance development

  • Alternative therapeutic modalities:

    • Peptide inhibitors:

      • Methodology: Design peptides mimicking interaction domains

      • Current status: Proof-of-concept for some histidine kinases

    • Nucleic acid-based approaches:

      • Methodology: Antisense oligonucleotides or CRISPR-based methods

      • Current status: Delivery challenges limit clinical application

    • Anti-virulence approaches:

      • Methodology: Target virulence regulation without killing bacteria

      • Current status: Emerging area with less selection pressure for resistance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.