Recombinant Rickettsia conorii Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
sdhD; RC0169; Succinate dehydrogenase hydrophobic membrane anchor subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
Target Protein Sequence
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMLW ELKKPFNVVALLITVVISLYHAMLGMRVVIEDYISYHKLRNTLIIIVQLFCIVTIVAFVV ALFYKG
Uniprot No.

Target Background

Function
Membrane-anchoring subunit of succinate dehydrogenase (SDH).
Database Links

KEGG: rco:RC0169

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) in Rickettsia conorii?

Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) is one of four nuclear-encoded subunits that compose the heterotetrameric succinate dehydrogenase complex (Complex II) in Rickettsia conorii. This complex serves as a critical link between the tricarboxylic acid cycle and the electron transport chain . The sdhD subunit specifically functions as a membrane anchor that helps embed the complex within the inner mitochondrial membrane. In Rickettsia species, this protein plays a crucial role in energy metabolism and may contribute to pathogenesis mechanisms.

To study this protein effectively, researchers should employ a combination of bioinformatic analysis of conserved domains and experimental membrane protein characterization techniques such as circular dichroism spectroscopy and fluorescence resonance energy transfer (FRET) analysis.

How does sdhD contribute to the assembly of the complete SDH complex in Rickettsia conorii?

The assembly of succinate dehydrogenase in Rickettsia conorii follows a coordinated process where each subunit must be independently translocated to the mitochondria before assembly into the mature complex within the inner membrane . The sdhD subunit is essential for this process as it contains transmembrane domains that anchor the complex in the membrane.

Methodologically, researchers investigating this assembly process should:

  • Use fluorescently tagged subunits to track localization during complex formation

  • Employ co-immunoprecipitation assays to identify interaction partners

  • Utilize site-directed mutagenesis to identify critical residues in the assembly process

  • Develop reconstitution assays using purified components to determine the sequential order of subunit assembly

The assembly pathway likely follows a specific order with chaperone proteins assisting in the process, similar to what has been observed in other bacterial systems.

What expression systems are most effective for producing recombinant Rickettsia conorii sdhD?

For optimal expression of Rickettsia conorii sdhD, researchers should consider the following expression systems based on the protein's membrane-associated nature:

Expression SystemAdvantagesLimitationsYieldRecommended Optimization Steps
E. coli with membrane protein tagsEstablished protocols, rapid growthMay form inclusion bodiesModerateUse lower induction temperatures (16-18°C), specialized strains (C41/C43)
Baculovirus-insect cellBetter folding of membrane proteinsHigher cost, longer timeHighOptimize MOI (multiplicity of infection), harvest timing
Cell-free systemsAvoids toxicity issuesLower yield, expensiveLow-ModerateSupplement with lipid nanodiscs or detergents
HEK293T cellsMammalian post-translational modificationsHighest costModerateSimilar to methods used for vitronectin peptides in referenced studies

When designing expression constructs, researchers should include appropriate fusion tags (His, GST, MBP) to aid in purification while being mindful of potential interference with membrane insertion. Expression optimization requires systematic testing of induction conditions, detergent screening, and stability assessment.

How can researchers effectively design experiments to study sdhD function and interactions?

When designing experiments to study sdhD function and interactions, researchers should follow a systematic approach:

  • Define clear variables: Identify independent variables (e.g., mutations in sdhD) and dependent variables (e.g., complex assembly efficiency, enzymatic activity)

  • Formulate testable hypotheses: Develop specific predictions about how alterations to sdhD structure affect function

  • Design appropriate controls: Include wild-type protein, inactive mutants, and unrelated membrane proteins as controls

  • Consider experimental treatments: Plan systematic mutations or environmental conditions to test

  • Assign appropriate measurement techniques: Select methods that can quantify the specific aspect of sdhD function being studied

For interaction studies specifically, researchers should:

  • Utilize pull-down assays with various tagged versions of sdhD

  • Employ surface plasmon resonance or microscale thermophoresis for binding kinetics

  • Validate interactions using multiple complementary techniques

  • Consider membrane environment effects on interactions

How do mutations in sdhD impact Rickettsia pathogenicity and metabolism?

Mutations in sdhD can significantly impact Rickettsia pathogenicity and metabolism through several mechanisms. Based on analogous studies with SDHD mutations in other systems, we know that these mutations can lead to:

  • Altered energy production: Disruption of electron transport chain function

  • Changes in metabolite accumulation: Particularly succinate, which may serve as a signaling molecule

  • Impaired membrane potential: Affecting various cellular processes dependent on membrane potential

To study these effects methodologically:

First, create site-directed mutants based on conserved residues identified through sequence alignment. Studies of SDH mutations in head and neck paragangliomas can provide guidance for potentially significant mutation sites . Second, assess metabolic consequences through metabolomics profiling, measuring oxygen consumption rates, and monitoring membrane potential using potentiometric dyes. Third, evaluate pathogenicity using standardized infection models, measuring bacterial loads, host cell viability, and inflammatory responses.

A meta-regression analysis of SDH mutations in other contexts has revealed significant correlations between specific mutation subtypes and clinically relevant outcomes, suggesting that different mutations may have distinct functional consequences .

What techniques are most effective for studying protein-protein interactions involving Rickettsia conorii sdhD?

For studying protein-protein interactions involving sdhD, researchers should employ multiple complementary approaches:

  • Co-immunoprecipitation with antibody controls: Similar to methods used to study Adr1 interactions, researchers should utilize specific antibodies against sdhD or potential binding partners, with appropriate controls to ensure specificity

  • Bacterial two-hybrid systems: Modified for membrane proteins, these systems can detect interactions in vivo

  • Proximity-based labeling: Methods such as BioID or APEX2 can identify proteins in close proximity to sdhD within the native membrane environment

  • Crosslinking mass spectrometry: This can capture transient interactions and provide structural information about binding interfaces

  • Surface plasmon resonance or microscale thermophoresis: For quantitative binding kinetics analysis

Note that interactions with membrane proteins like sdhD are particularly challenging due to their hydrophobic nature. The approach used to study Adr1 interactions with vitronectin provides a useful methodological template, where bacteria expressing the protein of interest are incubated with potential binding partners under various conditions (e.g., different salt concentrations, presence of competitors) .

How can structural analysis of sdhD inform antimicrobial development strategies?

Structural analysis of Rickettsia conorii sdhD provides valuable insights for antimicrobial development through several methodological approaches:

  • Homology modeling and molecular dynamics simulations:

    • Generate structural models based on available SDH structures

    • Simulate protein dynamics in membrane environments

    • Identify conserved regions distinct from human homologs

  • Identification of druggable pockets:

    • Use computational algorithms to identify binding sites

    • Focus on regions essential for assembly or catalytic function

    • Prioritize sites that differ from human SDH to minimize toxicity

  • Fragment-based screening:

    • Test libraries of small molecules for binding to recombinant sdhD

    • Validate hits using multiple biophysical techniques

    • Optimize fragments into lead compounds through medicinal chemistry

  • Structure-guided mutagenesis:

    • Create mutants at predicted binding sites

    • Evaluate effects on protein function and complex assembly

    • Use results to refine understanding of structure-function relationships

Insights from studies of Adr1, another Rickettsia membrane protein, suggest that targeting specific exposed loops that mediate essential protein-protein interactions may be a viable strategy for antimicrobial development .

What analytical methods best characterize the membrane integration of recombinant sdhD?

To effectively characterize membrane integration of recombinant sdhD, researchers should employ multiple complementary techniques:

When implementing these methods, researchers should consider that proteins like sdhD often require membrane-mimetic environments (detergent micelles, nanodiscs, or liposomes) to maintain their native conformation. Control experiments with known membrane proteins of similar size and complexity should be included to validate results.

How can researchers distinguish between phenotypes caused by sdhD mutation versus other metabolic changes?

Distinguishing between phenotypes directly caused by sdhD mutations versus secondary metabolic effects requires a rigorous experimental approach:

  • Complementation studies:

    • Express wild-type sdhD in mutant backgrounds to confirm phenotype rescue

    • Use inducible expression systems to titrate protein levels

    • Include enzymatically inactive versions as controls

  • Metabolic profiling:

    • Perform comprehensive metabolomics to identify altered pathways

    • Focus on TCA cycle intermediates and related compounds

    • Compare profiles with other respiratory chain mutants

  • Genetic suppressor screens:

    • Identify mutations that rescue sdhD phenotypes

    • Map suppressor mutations to specific pathways

    • Use these connections to build interaction networks

  • Time-resolved phenotyping:

    • Track the temporal order of phenotypic changes after sdhD disruption

    • Primary effects typically manifest before secondary consequences

  • Direct biochemical assays:

    • Measure SDH activity in isolated complexes

    • Compare with other respiratory complex activities

    • Quantify specific protein-protein interactions

This approach is consistent with experimental design principles that emphasize careful variable definition and specific hypothesis testing .

How do host-pathogen interactions influence sdhD function during Rickettsia conorii infection?

During Rickettsia conorii infection, host-pathogen interactions can significantly modulate sdhD function through several mechanisms:

  • Host immune response effects:

    • Complement activation, as observed in R. conorii infections, may influence bacterial metabolism

    • Inflammatory cytokines alter the host cellular environment, potentially affecting bacterial respiration

    • Oxidative stress from host immune cells may damage bacterial respiratory complexes

  • Metabolic adaptation:

    • R. conorii must adapt to changing nutrient availability within host cells

    • SDH complex activity may be regulated in response to these changes

    • Host mitochondrial function and bacterial metabolism likely exhibit crosstalk

To study these interactions methodologically:

  • Develop co-culture systems that allow measurement of SDH activity during infection

  • Use fluorescent reporters to monitor sdhD expression and complex assembly in real-time

  • Employ metabolic labeling to track carbon flow through central metabolism during infection

Recent studies have demonstrated that R. conorii infection increases serum concentration of complement activation markers, suggesting active engagement of host defense systems that may influence bacterial metabolism . Understanding how bacterial respiratory complexes respond to these stressors is crucial for comprehending pathogen adaptation.

What are the emerging computational approaches for predicting sdhD-small molecule interactions?

Emerging computational approaches for predicting interactions between sdhD and small molecules include:

  • Deep learning-based binding prediction:

    • Neural networks trained on protein-ligand interaction data

    • Particularly effective for membrane proteins with limited structural data

    • Requires careful model validation and experimental verification

  • Molecular dynamics with enhanced sampling:

    • Methods like metadynamics or replica exchange that improve conformational sampling

    • Can identify cryptic binding sites not visible in static structures

    • Provides insights into binding energetics and kinetics

  • Integrated systems biology models:

    • Combines structural predictions with metabolic models

    • Allows prediction of system-wide effects of sdhD inhibition

    • Helps identify potential off-target effects

  • Consensus scoring approaches:

    • Combines multiple prediction algorithms to improve accuracy

    • Reduces false positives common in single-method approaches

    • Provides confidence metrics for prioritizing experimental validation

These computational approaches should be implemented as part of an iterative process where predictions inform experimental design, and experimental results refine computational models. This approach is particularly valuable given the technical challenges of working with membrane proteins like sdhD.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.