Recombinant Rickettsia conorii Uncharacterized protein RC0143 (RC0143)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Rickettsia conorii Uncharacterized Protein RC0143 (RC0143) is a full-length protein derived from Rickettsia conorii, a pathogenic bacterium causing Mediterranean spotted fever. As its name suggests, this protein remains biochemically uncharacterized, with no established functional role in R. conorii pathogenesis or cellular processes. Below are its key attributes:

ParameterValue
Cat. No.RFL10671RF
SpeciesRickettsia conorii
SourceExpressed in E. coli
TagN-terminal His tag
Protein LengthFull-length mature protein (25–661 amino acids)
FormLyophilized powder
Purity>90% (SDS-PAGE confirmed)
Storage-20°C/-80°C (aliquoted); avoid repeated freeze-thaw cycles

Amino Acid Sequence Highlights

A partial sequence example (truncated for brevity):
GFGESCSSLPTTSDGYLETDTAYGYIIRNIDMKDPRGNCNSVASSITFCFKNVEGSSSPCTMYTLNEGDSKKISDLSTDNNPDLGANPVLKNIVLTVKKWDNDLCLVMPTSRGPMPVACKSLSATPTPPPSEDKNCNIGKSCYTGANYSQSLINFSGLAVQCLSETLNKIFFAGKSCSAQDQNSRITNLAAFSTFQGYLKRIIGAALILYTMFFAFNMALNTEYASTEKIALFVIKFLFVAYFSIGLGPLDFSGGQPTKENGMLKYGLPLLTGAAPDFAQMIFNAAGSRGLCQFDNSKYKDGYKFYGLWDAIDCRIGYYLGLDLLYNIDKNRVLGNVVGNGPRGNNTPIPNFDPEGKNDRPKDLSKAGALRFFTVMFGFFMAGNVIILAAGLVFSVIFLSILLYFITHYLVCMITIYVMTYISPIFIPMALFTRTKAYFDGWLKVCISCALQPAVVAGFIALLITMYDSAIFKNCEFLRYDYERGDIRFSTFELRLPVGGADKCQESFGYKMLEYYAGKGWEEHLLILFPIKSIVRDVVSILAELLCVLVFSVIFYYFSKSIGRFASDLTNGPNMDAVTASPTKIVGLVKKGAAFLKDAAMASQGKPLVGDKPGVGGKRKEGEQQGGDLASGSGGGK .

Production and Handling

RC0143 is synthesized in E. coli, purified via affinity chromatography (His-tag), and lyophilized for storage. Critical handling guidelines include:

ParameterRecommendation
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); add 5–50% glycerol for stability
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Freezing/ThawingAvoid repeated cycles; aliquot for long-term storage

Research Status and Applications

RC0143 is marketed as a research tool for studying Rickettsia conorii biology, though no peer-reviewed studies directly investigating its function have been reported. Potential applications include:

  • Antigen Studies: As a candidate for serological assays or vaccine development.

  • Protein-Protein Interaction Screening: To identify binding partners in Rickettsia or host cells.

  • Structural Biology: For crystallization or NMR studies to elucidate its 3D conformation.

Limitations and Gaps

  • Functional Anonymity: No enzymatic activity, localization, or interaction data are available.

  • Pathogenic Relevance: No evidence links RC0143 to R. conorii virulence or host colonization.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us; we will prioritize its use in production.
Synonyms
RC0143; Uncharacterized protein RC0143
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-661
Protein Length
Full Length of Mature Protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
RC0143
Target Protein Sequence
GFGESCSSLPTTSDGYLETDTAYGYIIRNIDMKDPRGNCNSVASSITFCFKNVEGSSSPC TMYTLNEGDSKKISDLSTDNNPDLGANPVLKNIVLTVKKWDNDLCLVMPTSRGPMPVACK SLSATPTPPPSEDKNCNIGKSCYTGANYSQSLINFSGLAVQCLSETLNKIFFAGKSCSAQ DQNSRITNLAAFSTFQGYLKRIIGAALILYTMFFAFNMALNTEYASTEKIALFVIKFLFV AYFSIGLGPLDFSGGQPTKENGMLKYGLPLLTGAAPDFAQMIFNAAGSRGLCQFDNSKYK DGYKFYGLWDAIDCRIGYYLGLDLLYNIDKNRVLGNVVGNGPRGNNTPIPNFDPEGKNDR PKDLSKAGALRFFTVMFGFFMAGNVIILAAGLVFSVIFLSILLYFITHYLVCMITIYVMT YISPIFIPMALFTRTKAYFDGWLKVCISCALQPAVVAGFIALLITMYDSAIFKNCEFLRY DYERGDIRFSTFELRLPVGGADKCQESFGYKMLEYYAGKGWEEHLLILFPIKSIVRDVVS ILAELLCVLVFSVIFYYFSKSIGRFASDLTNGPNMDAVTASPTKIVGLVKKGAAFLKDAA MASQGKPLVGDKPGVGGKRKEGEQQGGDLASGSGGGK
Uniprot No.

Target Background

Database Links

KEGG: rco:RC0143

Protein Families
TrbL/VirB6 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are commonly used for producing recombinant RC0143 protein?

Recombinant RC0143 can be produced in several expression systems, with E. coli being the most commonly utilized. Current research indicates that the following expression systems are employed for RC0143 production:

Expression SystemAdvantagesTag OptionsApplications
E. coliHigh yield, cost-effective, rapid expressionHis-tag, commonly N-terminalBasic biochemical characterization, antibody production
YeastPost-translational modifications, proper foldingVariable, determined during production processFunctional studies requiring eukaryotic modifications
BaculovirusCloser to native conformation, complex proteinsVarious options availableAdvanced structural studies, functional assays
Mammalian cellsMost native-like PTMs and foldingUsually determined during productionInteraction studies, high-fidelity functional assays

When selecting an expression system, researchers should consider the experimental requirements and downstream applications, as the system can significantly impact protein folding, post-translational modifications, and biological activity .

What storage conditions are recommended for maintaining recombinant RC0143 stability?

To maintain optimal stability of recombinant RC0143 protein, the following storage conditions are recommended:

  • Store at -20°C for regular storage

  • For extended storage, conserve at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • Working aliquots can be stored at 4°C for up to one week

  • The protein is typically supplied in a Tris-based buffer with 50% glycerol

For reconstitution of lyophilized protein:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is common) for cryoprotection

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

These storage recommendations are essential for maintaining protein integrity and ensuring reliable experimental results over time .

What approaches can be used to elucidate the potential function of uncharacterized proteins like RC0143?

Elucidating the function of uncharacterized proteins like RC0143 requires a multi-faceted approach:

A systematic implementation of these approaches, starting with computational predictions to guide experimental design, offers the best strategy for functional characterization .

How can experimental design principles be applied to studying potential interactions of RC0143 with host proteins?

Designing experiments to study potential interactions between RC0143 and host proteins requires careful planning and execution:

  • Hypothesis Formulation:

    • Based on bioinformatic predictions and known Rickettsia-host interactions

    • Consider subcellular localization predictions for targeted host protein selection

    • Formulate specific, testable hypotheses about potential interaction partners

  • Experimental Design Selection:

    • True experimental designs: When you can fully control variables and randomize conditions

    • Quasi-experimental designs: When complete control is not possible

    • Pre-experimental observational studies: For initial screening approaches

  • Independent Variable Manipulation:

    • Expression levels of RC0143 (wild-type vs. mutants)

    • Host cell types or conditions (e.g., activation states)

    • Bacterial infection parameters (MOI, time points)

  • Control Implementation:

    • Negative controls: Unrelated bacterial proteins with similar properties

    • Positive controls: Known Rickettsia-host protein interactions

    • Technical controls: Tag-only constructs, buffer-only conditions

  • Measurement Methods:

    • Direct binding assays: SPR, BLI, ITC

    • Pull-down assays with mass spectrometry identification

    • Proximity labeling approaches (BioID, APEX)

    • FRET or BiFC for in-cell interaction validation

    • Co-localization studies using confocal microscopy

  • Study Validation:

    • Reproducibility across multiple experimental setups

    • Dose-response relationships to establish specificity

    • Competitive binding assays

    • Mutagenesis of predicted interaction interfaces

When designing these experiments, researchers should consider the strengths and limitations of each approach. For example, in vitro binding studies offer high control but may not reflect in vivo conditions, while cell-based assays provide physiological relevance but introduce more variables .

What experimental challenges are specific to working with uncharacterized Rickettsia proteins like RC0143?

Working with uncharacterized Rickettsia proteins like RC0143 presents several unique experimental challenges:

  • Expression and Purification Difficulties:

    • Membrane-associated regions can complicate expression

    • Potential toxicity to expression hosts

    • Improper folding due to missing chaperones or cofactors

    • Aggregation issues in heterologous expression systems

    • Low solubility requiring optimization of buffer conditions

  • Functional Prediction Obstacles:

    • Limited sequence similarity to well-characterized proteins

    • Rickettsia-specific functions with no counterparts in model organisms

    • Potential multifunctional nature common in bacterial pathogens

    • Context-dependency of function based on infection stage

  • Technical Limitations:

    • Difficulties in Rickettsia genetic manipulation for validation studies

    • Obligate intracellular lifestyle complicating in vivo functional studies

    • Biosafety requirements limiting certain experimental approaches

    • Limited availability of Rickettsia-specific research tools

  • Experimental Design Considerations:

    • Selection of appropriate controls when function is unknown

    • Designing assays without functional hypotheses

    • Balancing breadth vs. depth in exploratory studies

    • Determining physiologically relevant conditions for assays

  • Result Interpretation Complexities:

    • Distinguishing specific from non-specific interactions

    • Correlating in vitro observations with in vivo relevance

    • Potential artifacts from tag interference

    • Publication challenges when definitive function remains elusive

Addressing these challenges requires creative experimental approaches, careful controls, and often a combination of methods to build converging lines of evidence regarding protein function .

What are the optimal methodological approaches for studying potential post-translational modifications of RC0143?

Studying potential post-translational modifications (PTMs) of RC0143 requires a strategic combination of computational prediction, production system selection, and analytical techniques:

  • Computational Prediction:

    • Utilize specialized algorithms for PTM prediction:

      • NetPhos for phosphorylation sites

      • GlycoMine for glycosylation sites

      • SUMOplot for SUMOylation sites

      • GPS-PAIL for acetylation sites

    • Cross-reference predictions with structural accessibility data

    • Compare with PTMs found in homologous proteins

  • Expression System Selection:

    Expression SystemPTM CapabilityAdvantagesLimitations
    E. coliLimited (some phosphorylation)High yield, cost-effectiveLacks most eukaryotic PTMs
    YeastModerate (glycosylation, phosphorylation)Scalable, cost-effectiveDifferent glycosylation patterns
    Insect cellsGood (phosphorylation, glycosylation)Closer to mammalianSome PTM machinery differences
    Mammalian cellsExcellent (most PTMs)Most authentic PTMsHigher cost, lower yield
  • Analytical Techniques:

    • Mass Spectrometry Approaches:

      • Bottom-up proteomics for site identification

      • Enrichment strategies (IMAC, TiO2) for phosphopeptides

      • Electron transfer dissociation (ETD) for labile PTMs

      • Multiple reaction monitoring (MRM) for targeted analysis

    • Biochemical Detection:

      • Western blotting with PTM-specific antibodies

      • ProQ Diamond staining for phosphoproteins

      • Periodic acid-Schiff staining for glycoproteins

      • Click chemistry for detecting specific modifications

  • Validation Methods:

    • Site-directed mutagenesis of predicted PTM sites

    • In vitro enzymatic addition/removal of PTMs

    • Pharmacological inhibition of PTM enzymes

    • Functional assays comparing modified and unmodified forms

  • Native PTM Assessment:

    • Analysis of RC0143 purified directly from Rickettsia

    • Comparison between recombinant and native forms

    • Temporal analysis during infection cycle

    • Condition-dependent modification patterns

When studying PTMs, it's crucial to consider their biological context and potential functional significance, particularly in host-pathogen interactions where PTMs may be dynamically regulated during infection .

How can researchers effectively design quasi-experimental studies to investigate RC0143's role in pathogenesis?

Designing quasi-experimental studies to investigate RC0143's role in pathogenesis requires careful consideration of various factors when complete experimental control is not possible:

  • Study Design Selection:

    • Non-equivalent control group designs: Compare infection outcomes with different Rickettsia strains (wild-type vs. RC0143 mutants)

    • Interrupted time series designs: Analyze infection progression at multiple timepoints

    • Regression discontinuity designs: Examine threshold effects of RC0143 expression levels

    • Matched-pairs designs: Compare closely related Rickettsia species with/without RC0143 homologs

  • Control Strategy Implementation:

    Control TypeImplementation in RC0143 StudiesAdvantage
    Historical controlsCompare with previously characterized Rickettsia virulence factorsLeverages existing knowledge
    Statistical controlsMultivariate analysis controlling for confounding variablesAccounts for complex interactions
    Internal controlsWithin-sample comparisons (e.g., affected vs. unaffected cells)Reduces subject variability
    Instrumental variablesUse proxies when direct manipulation is not possibleAllows causal inference
  • Validity Enhancement Approaches:

    • Maximize internal validity:

      • Use multiple control conditions

      • Implement blinding in analysis phases

      • Standardize experimental protocols

      • Perform pilot studies to identify confounders

    • Strengthen external validity:

      • Test across multiple cell types

      • Include primary cells and tissue models

      • Vary experimental conditions

      • Validate in different model systems

  • Data Collection Planning:

    • Establish clear temporal sampling points

    • Use mixed methods (quantitative and qualitative)

    • Implement standardized outcome measures

    • Plan for sufficient replication and sample size

  • Analysis Strategy Development:

    • Pre-specify primary and secondary outcomes

    • Plan appropriate statistical approaches:

      • Difference-in-differences analysis

      • Propensity score matching

      • Interrupted time series analysis

      • Structural equation modeling

    • Include sensitivity analyses to test assumptions

When full experimental control is not feasible (e.g., when working with clinical samples or when genetic manipulation is limited), quasi-experimental designs offer rigorous alternatives that can still yield valuable insights into RC0143's role in pathogenesis .

What approaches should researchers use to study potential conformational changes of RC0143 during infection?

Investigating conformational changes of RC0143 during infection requires sophisticated techniques that can capture dynamic structural alterations in complex biological contexts:

This multi-faceted approach allows researchers to comprehensively characterize RC0143's structural dynamics during the infection process, potentially revealing mechanistic insights into its function .

How should researchers analyze conflicting results when characterizing RC0143 function?

When faced with conflicting results during RC0143 functional characterization, researchers should implement a systematic approach to resolve discrepancies:

  • Critical Evaluation of Methodological Differences:

    • Compare experimental conditions in detail:

      • Expression systems used (E. coli, yeast, mammalian cells)

      • Protein constructs (full-length vs. truncated)

      • Tags and their positions (N-terminal vs. C-terminal)

      • Buffer compositions and pH conditions

    • Assess technical variables:

      • Detection methods and their sensitivities

      • Time points and kinetic considerations

      • Sample preparation procedures

      • Equipment calibration and settings

  • Statistical Reassessment:

    • Evaluate statistical power and sample sizes

    • Consider different statistical tests appropriate for the data

    • Perform meta-analysis when multiple datasets exist

    • Test for batch effects or hidden variables

  • Biological Context Consideration:

    Context FactorPotential Impact on ResultsResolution Approach
    Cell type differencesVariation in cofactors or interaction partnersTest across multiple cell types
    Infection stageDifferent functions at different stagesTime-course experiments
    Environmental conditionsContext-dependent activitySystematic variation of conditions
    Strain variationsAllelic differences affecting functionSequence comparison and mutagenesis
  • Independent Validation Strategies:

    • Employ orthogonal techniques for key observations

    • Collaborate with independent laboratories

    • Use different experimental approaches to test the same hypothesis

    • Develop positive and negative controls specific to each assay

  • Reconciliation Framework:

    • Consider multifunctionality as an explanation

    • Develop context-dependent models of protein function

    • Identify threshold effects or non-linear responses

    • Map discrepancies to specific domains or conditions

  • Transparent Reporting:

    • Document all conflicting results

    • Provide raw data and detailed methods

    • Discuss possible explanations for discrepancies

    • Present multiple working hypotheses when conclusive evidence is lacking

By systematically addressing conflicting results, researchers can often discover important nuances in protein function that might be missed by simpler interpretations .

What bioinformatic approaches are most effective for predicting functional domains in uncharacterized proteins like RC0143?

Predicting functional domains in uncharacterized proteins like RC0143 requires a multi-layered bioinformatic approach:

  • Sequence-Based Domain Prediction:

    • Profile-based methods:

      • HMMER searches against Pfam and SMART databases

      • Position-specific scoring matrices (PSSMs)

      • Profile-profile alignments with HHpred

    • Conservation-based approaches:

      • Multiple sequence alignment across homologs

      • Evolutionary trace analysis

      • Conservation scoring (ConSurf, Rate4Site)

    • Machine learning methods:

      • Neural networks trained on known domains

      • Support vector machines for boundary prediction

      • Deep learning approaches (AlphaFold-based domain identification)

  • Structural Prediction Integration:

    • Domain boundary prediction based on:

      • Secondary structure transitions

      • Intrinsically disordered regions

      • Domain linker prediction (DLP, DomCut)

    • Tertiary structure prediction:

      • AlphaFold2 for full-length modeling

      • RoseTTAFold for domain fold recognition

      • I-TASSER for threading-based domain identification

  • Functional Site Prediction:

    Prediction TypeTools/MethodsApplication to RC0143
    Binding sitesFTSite, COACH, SiteMapIdentify potential ligand/protein interaction surfaces
    Catalytic sitesCSA, POOL, CatSEEDetect potential enzymatic activity sites
    Post-translational modification sitesNetPhos, GlycoMine, GPSPredict regulatory sites
    Transmembrane regionsTMHMM, Phobius, TOPCONSIdentify membrane-association domains
    Signal peptides and localizationSignalP, TargetP, PSORTPredict cellular targeting domains
  • Network-Based Function Prediction:

    • Genomic context methods:

      • Gene neighborhood analysis

      • Fusion protein detection

      • Phylogenetic profiling

    • Protein-protein interaction predictions:

      • Interolog mapping

      • Co-expression networks

      • Domain-domain interaction databases

  • Evaluation and Validation Strategy:

    • Confidence assessment:

      • Statistical significance evaluation

      • Cross-validation across methods

      • Consensus approaches combining multiple predictors

    • Experimental design for validation:

      • Domain truncation experiments

      • Site-directed mutagenesis of predicted sites

      • Chimeric protein construction

By integrating these computational approaches, researchers can generate testable hypotheses about RC0143's domains that guide subsequent experimental characterization. The analysis of RC0143's 637-amino acid sequence would benefit particularly from transmembrane prediction and structural modeling to identify potential functional regions .

How can researchers effectively evaluate the quality and reliability of recombinant RC0143 preparations for experimental use?

Evaluating the quality and reliability of recombinant RC0143 preparations requires a comprehensive assessment approach:

  • Purity Assessment:

    • SDS-PAGE analysis:

      • Visualize protein bands with Coomassie or silver staining

      • Quantify purity using densitometry (aim for >90% purity)

      • Detect potential degradation products or aggregates

    • Chromatographic techniques:

      • Size-exclusion chromatography to assess homogeneity

      • Reverse-phase HPLC for purity quantification

      • Ion-exchange chromatography to separate charge variants

  • Identity Confirmation:

    • Mass spectrometry verification:

      • Intact mass analysis to confirm molecular weight

      • Peptide mass fingerprinting after proteolytic digestion

      • Sequence coverage analysis (aim for >80% coverage)

    • Immunological methods:

      • Western blotting with anti-His tag antibodies

      • Epitope-specific antibodies if available

      • Mass spectrometry immunoassay (MSIA)

  • Structural Integrity Evaluation:

    TechniqueInformation ProvidedAcceptance Criteria
    Circular dichroismSecondary structure contentConsistent spectra across batches
    Fluorescence spectroscopyTertiary structure environmentReproducible emission maxima
    Thermal shift assayProtein stability and foldingConsistent melting temperature
    Dynamic light scatteringAggregation stateMonodisperse population
    Limited proteolysisDomain organizationReproducible digestion pattern
  • Functional Activity Assessment:

    • Binding assays:

      • Surface plasmon resonance with predicted partners

      • ELISA-based interaction studies

      • Pull-down assays to verify interaction capabilities

    • Activity assays:

      • Based on bioinformatic predictions

      • Comparative assays against related proteins

      • Development of surrogate activity markers

  • Batch Consistency Evaluation:

    • Critical quality attribute monitoring:

      • Establishing acceptance criteria for key parameters

      • Trend analysis across multiple batches

      • Reference standard comparison

    • Stability profiling:

      • Accelerated stability studies

      • Real-time stability monitoring

      • Freeze-thaw cycle testing

  • Contaminant Analysis:

    • Endotoxin testing (crucial for immunological studies)

    • Host cell protein quantification

    • DNA contamination assessment

    • Bioactivity interference testing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.