Recombinant Rickettsia conorii Uncharacterized protein RC0660 (RC0660)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
RC0660; Uncharacterized protein RC0660
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
RC0660
Target Protein Sequence
MPSSYKLRKKIWKSVYLLITVGILYIGYILIKSGYINEKNDINVTKKSLKDNKNFDLKYN IILKDSIFEGVNKNLNAYKIKTERAIKESNNKYKLDIINAIYNVNQDQTLIINAKEGFLD EESSILDLKNDVKLFFDEIIFNTNDARIDLVNKNITGHSPAKLLYKNSSITSDSFNTKDE NNIIIFKGNVSTIIDLSD
Uniprot No.

Target Background

Database Links

KEGG: rco:RC0660

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is RC0660 and why is it significant for research?

RC0660 is an uncharacterized protein from Rickettsia conorii, a Gram-negative, obligate intracellular bacterium that causes Mediterranean spotted fever and related diseases . This protein consists of 198 amino acids and is of particular interest because it shows differential expression patterns between tick vector and human host cells, suggesting a potential role in host adaptation mechanisms . Studying uncharacterized proteins like RC0660 is crucial for understanding pathogen biology and discovering novel therapeutic targets.

What are the optimal methods for expressing recombinant RC0660?

For optimal expression of recombinant RC0660, E. coli is the preferred heterologous expression system . The protocol typically involves:

  • Cloning the RC0660 gene into an expression vector with a His-tag (typically N-terminal)

  • Transforming the construct into an expression strain such as BL21(DE3)

  • Inducing expression with IPTG (0.5-1mM) when culture reaches mid-log phase

  • Harvesting cells after 3-4 hours induction at 37°C or overnight at 16-18°C to minimize inclusion body formation

  • Lysing cells using sonication or pressure-based methods in a buffer containing 50mM Tris, 300mM NaCl, pH 8.0 with protease inhibitors

When optimizing expression conditions, researchers should test different temperatures (16°C, 25°C, 37°C), IPTG concentrations, and induction times to maximize soluble protein yield.

What are the challenges in purifying RC0660 and how can they be addressed?

Purification of RC0660 presents several challenges common to uncharacterized bacterial proteins:

  • Solubility issues: Being potentially membrane-associated, RC0660 may have solubility challenges. Consider using mild detergents (0.1% Triton X-100 or 1% CHAPS) during lysis and purification.

  • Purity concerns: To achieve >90% purity as required for structural and functional studies , implement a multi-step purification process:

    • Initial IMAC (immobilized metal affinity chromatography) using Ni-NTA resin

    • SEC (size exclusion chromatography) to remove aggregates and contaminants

    • Ion exchange chromatography if additional purification is needed

  • Stability problems: RC0660 may have limited stability in solution. Optimize storage buffer with stabilizers:

    • Include 6% trehalose in Tris/PBS-based buffer at pH 8.0

    • Add 5-50% glycerol for long-term storage

    • Store in small aliquots at -80°C to avoid freeze-thaw cycles

What computational methods can predict the structure of RC0660?

Given the lack of experimentally determined structures for RC0660, researchers can employ several computational approaches:

How can experimental approaches be used to determine RC0660 structure?

For experimental determination of RC0660 structure, consider a multi-method approach:

  • X-ray crystallography:

    • High-throughput crystallization screening (96-well formats with commercial kits)

    • Optimization of promising conditions (varying pH, salt concentration, precipitant levels)

    • Consider surface entropy reduction mutations to improve crystallizability

    • Data collection at synchrotron facilities and structure solution using molecular replacement or experimental phasing

  • NMR spectroscopy (for structural dynamics studies):

    • Expression of 15N and 13C labeled protein

    • Collection of 2D/3D NMR spectra (HSQC, NOESY, TOCSY)

    • Structure calculation based on distance restraints

  • Cryo-EM (if part of larger complexes):

    • Sample vitrification

    • Data collection and processing

    • Model building and refinement

How can RC0660 function be predicted computationally?

To predict RC0660 function computationally, implement a structured in-silico approach :

  • Sequence analysis:

    • Search for conserved domains using CDD, Pfam, and InterPro

    • Identify sequence motifs using PROSITE

    • Analyze transmembrane regions and signal peptides (TMHMM, SignalP)

  • Phylogenetic analysis:

    • Identify orthologs in related species

    • Construct phylogenetic trees to understand evolutionary relationships

    • Look for conservation patterns that might indicate functional importance

  • Protein-protein interaction predictions:

    • Use STRING database to identify potential interaction partners

    • Analyze co-expression patterns with known proteins

    • Predict functional associations based on genomic context

  • Physicochemical properties analysis:

    • Calculate parameters (MW, pI, GRAVY index, aliphatic index)

    • Predict subcellular localization

    • Analyze secondary structure elements

What experimental methods are recommended for functional characterization of RC0660?

For experimental functional characterization of RC0660, consider:

  • Gene knockout/knockdown studies:

    • Generate RC0660 deletion mutants in R. conorii (if genetic manipulation is possible)

    • Assess phenotypic changes in growth, survival, or virulence

    • Complementation studies to confirm phenotype specificity

  • Protein-protein interaction studies:

    • Pull-down assays using His-tagged RC0660

    • Co-immunoprecipitation to identify interaction partners

    • Yeast two-hybrid or bacterial two-hybrid screening

    • Crosslinking followed by mass spectrometry to stabilize interactions

  • Localization studies:

    • Immunofluorescence microscopy using antibodies against RC0660

    • Subcellular fractionation followed by Western blotting

    • Electron microscopy with immunogold labeling

  • Functional assays:

    • Binding studies with potential ligands

    • Enzymatic activity assays based on bioinformatic predictions

    • Host cell interaction studies (adhesion, invasion, intracellular survival)

How is RC0660 expression regulated in different host environments?

RC0660 shows differential expression between tick vector and human host cells . To study this regulation:

  • Comparative transcriptomics:

    • RNA-Seq of R. conorii from different host cell types (tick cells vs. human endothelial cells)

    • RT-qPCR validation of differential expression

    • Identification of conditions affecting expression (temperature, pH, nutrient availability)

  • Promoter analysis:

    • Identify promoter regions and potential regulatory elements

    • Reporter gene assays with GFP or luciferase fused to the RC0660 promoter

    • Analysis of transcription factor binding sites

  • Epigenetic regulation:

    • Analysis of DNA methylation patterns

    • Chromatin immunoprecipitation to identify protein-DNA interactions

    • Study of post-transcriptional regulation mechanisms

What methodological approaches can determine RC0660's role in host adaptation?

To investigate RC0660's role in host adaptation:

  • Comparative infection studies:

    • Infection of tick cells (AAE2) and human microvascular endothelial cells (HMECs)

    • Assessment of bacterial growth, persistence, and host cell responses

    • Monitoring changes in RC0660 expression during different infection phases

  • Environmental stimuli response:

    • Expose bacteria to different temperatures (tick vs. mammalian host)

    • Mimic other host-specific conditions (pH, oxidative stress, nutrient availability)

    • Monitor RC0660 expression changes under these conditions

  • Heterologous expression in host cells:

    • Express RC0660 in mammalian or tick cells

    • Assess effects on cell signaling, cytoskeletal arrangements, or inflammatory responses

    • Identify host proteins interacting with RC0660

How can systems biology approaches be applied to understanding RC0660's role in Rickettsia pathogenesis?

Applying systems biology approaches to RC0660 research:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Create protein-protein interaction networks including RC0660

    • Develop mathematical models of pathogen-host interactions

  • Pathway analysis:

    • Identify pathways affected by RC0660 expression

    • Map RC0660 into known bacterial virulence mechanisms

    • Predict effects of RC0660 perturbation on system-wide function

  • Co-expression network analysis:

    • Identify genes co-expressed with RC0660 under different conditions

    • Construct functional modules based on expression patterns

    • Infer function through guilt-by-association approaches

What are the potential applications of RC0660 research in vaccine or therapeutic development?

Research on RC0660 has several potential applications:

  • Vaccine development:

    • Evaluate RC0660 as a potential vaccine antigen

    • Test recombinant RC0660 for immunogenicity and protective efficacy

    • Develop epitope-based vaccines targeting conserved regions of RC0660

  • Therapeutic targeting:

    • Assess RC0660 as a drug target (if essential for bacterial survival)

    • Develop small molecule inhibitors or antibodies against RC0660

    • Test combinations with existing antibiotics for enhanced efficacy

  • Diagnostic applications:

    • Develop antibody-based detection methods for R. conorii infection

    • Create RC0660-based diagnostic tests for Mediterranean spotted fever

    • Monitor RC0660 expression as a biomarker for disease progression

How does RC0660 compare to other uncharacterized proteins in Rickettsia species?

To compare RC0660 with other uncharacterized proteins:

  • Comparative genomics analysis:

    • Identify orthologs across Rickettsia species

    • Compare sequence conservation, genomic context, and domain architecture

    • Analyze gene presence/absence patterns across pathogenic and non-pathogenic species

  • Phylogenetic profiling:

    • Construct phylogenetic trees of RC0660 homologs

    • Correlate evolutionary patterns with pathogenicity or host specificity

    • Identify co-evolving protein families

The following table summarizes comparisons between RC0660 and other uncharacterized Rickettsia proteins:

ProteinSpeciesSequence Identity to RC0660Host-specific ExpressionPredicted FunctionConservation
RC0660R. conorii100%Tick cells > Human cellsMembrane-associated proteinSpotted fever group
RC0419R. conorii<20%Below detection in both hostsUnknownLimited
RC0453R. conorii<15%Below detection in both hostsUnknownLimited
RC0757R. conorii<10%Tick cells onlyIntegration host factor beta subunitModerate
RC0511R. conorii<25%Tick cells > Human cellsAbrB family transcriptional regulatorModerate

What methodological approaches can be used to study RC0660 in the context of host-pathogen interface?

To study RC0660 at the host-pathogen interface:

  • Cell culture infection models:

    • Infection of tick cells and human endothelial cells with R. conorii

    • Time-course analysis of RC0660 expression and localization

    • Assessment of host cell responses to wild-type vs. RC0660-deficient bacteria

  • Animal infection models:

    • Establish suitable animal models for R. conorii infection

    • Compare infection dynamics of wild-type vs. RC0660-modified strains

    • Evaluate tissue tropism and pathological changes

  • Advanced microscopy techniques:

    • Super-resolution microscopy to visualize RC0660 during infection

    • Live-cell imaging to track dynamic processes

    • Correlative light and electron microscopy for ultrastructural context

How can researchers integrate transcriptomic and proteomic data to better understand RC0660 function?

For integrating multi-omics data related to RC0660:

  • Data collection and standardization:

    • Generate RNA-Seq data from R. conorii under different conditions

    • Perform proteomics analysis focusing on RC0660 interactors

    • Standardize data formats for integration

  • Correlation analysis:

    • Compare transcriptomic and proteomic profiles

    • Identify concordant and discordant patterns

    • Correlate RC0660 expression with global changes

  • Network construction:

    • Build integrated protein-protein interaction networks

    • Incorporate transcriptional regulation information

    • Map post-translational modifications

  • Visualization and interpretation:

    • Create interactive visualizations of integrated data

    • Identify functional clusters and pathways

    • Generate testable hypotheses about RC0660 function

What bioinformatic pipelines are recommended for analyzing RC0660 in the context of host-specific adaptation?

For bioinformatic analysis of RC0660 in host adaptation:

  • Differential expression analysis pipeline:

    • Quality control of RNA-Seq data (FastQC)

    • Read alignment to reference genome (HISAT2, STAR)

    • Expression quantification (featureCounts, HTSeq)

    • Differential expression analysis (DESeq2, edgeR)

    • Visualization (heatmaps, volcano plots)

  • Comparative genomics workflow:

    • Genome alignment of multiple Rickettsia species

    • Identification of orthologous genes

    • Analysis of selection pressure (dN/dS ratio)

    • Detection of recombination events

  • Protein structure prediction and analysis:

    • Structure prediction (AlphaFold, SWISS-MODEL)

    • Structure comparison across species

    • Functional site prediction

    • Molecular dynamics simulations under different conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.