Recombinant Rickettsia conorii UPF0092 membrane protein RC0893 (RC0893)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request, but will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yajC; RC0893; Sec translocon accessory complex subunit YajC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Target Names
yajC
Target Protein Sequence
MSANTQDNQANNNDTIEIQETEVVPAETNSLQSGLTSLIPMVLIFAVFYFLLLRPQETRR KEREKLVSEVKKGEEVLTNSGIYGIVTKVSENDNNIEIEIAKDVRIKVLKSAIIDITSRT KEVAVKKENKKNKKVSGAKAS
Uniprot No.

Target Background

Function

The SecYEG-SecDF-YajC-YidC holo-translocon (HTL) protein secretase/insertase is a supercomplex essential for protein secretion, membrane protein insertion, and the assembly of membrane protein complexes. While the SecYEG complex is crucial for the assembly of numerous proteins and complexes, the SecDF-YajC-YidC subcomplex facilitates these processes.

Database Links

KEGG: rco:RC0893

Protein Families
YajC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the functional role of RC0893 in Rickettsia conorii?

RC0893 functions as a preprotein translocase YajC, primarily involved in protein secretion mechanisms within R. conorii . As an inner membrane protein, it participates in the transport machinery that facilitates protein translocation across bacterial membranes. While not classified as druggable according to current analyses, its role in protein transport makes it an important component in understanding R. conorii pathogenesis . YajC-family proteins typically function as auxiliary components of the Sec translocon system, working in conjunction with other translocation machinery proteins to facilitate proper protein secretion and membrane insertion.

How is RC0893 classified within the broader context of R. conorii proteins?

RC0893 is classified within the following structural and functional categories:

CharacteristicClassification
Sequence IDRC0893
DomainPreprotein_translocase_YajC
Functional CategoryProtein secretion
Broad ClassTransport
Subcellular LocalizationInner membrane
DruggabilityNo

This classification places RC0893 among the transport proteins of R. conorii, specifically those involved in protein translocation mechanisms rather than among the well-characterized outer membrane proteins (like rOmpA or rOmpB) that directly mediate host cell adhesion and invasion .

What expression systems are recommended for recombinant production of RC0893?

For recombinant expression of RC0893, E. coli-based systems represent the preferred platform due to their established use in expressing rickettsial proteins. Specifically:

  • BL21(DE3) Expression System: Utilizing pET-based vectors with IPTG-inducible promoters offers controlled expression of the membrane protein.

  • Fusion Tag Selection: For membrane proteins like RC0893, N-terminal fusion with tags like MBP (maltose-binding protein) or SUMO can improve solubility while maintaining native conformation.

  • Membrane Protein-Specific Considerations: Expression should be conducted at reduced temperatures (16-20°C) following induction to minimize inclusion body formation. Incorporation of specific E. coli strains engineered for membrane protein expression (C41/C43) may further enhance yield.

  • Detergent Selection: Initial screening with a panel of detergents (DDM, LDAO, or Triton X-100) is essential for optimal solubilization while maintaining structural integrity during purification processes.

This approach is similar to methods successfully employed for other R. conorii membrane proteins, though specific optimization for RC0893 may be necessary based on its unique characteristics.

How does RC0893 interact with the host cell machinery during R. conorii infection?

While RC0893 itself has not been directly characterized for host-pathogen interactions, its function as a protein translocase component suggests potential roles in the secretion pathway of virulence factors. Research approaches to investigate this question should include:

  • Protein-Protein Interaction Studies: Implementing techniques such as bacterial two-hybrid screening, co-immunoprecipitation, or proximity labeling methods (BioID) to identify potential interaction partners within both bacterial and host proteomes.

  • Conditional Knockout/Knockdown Experiments: Using inducible systems to modulate RC0893 expression during infection to evaluate its impact on virulence factor secretion and subsequent host cell responses.

  • Comparative Analysis: Evaluating RC0893 in relation to other secretion-related proteins in R. conorii that facilitate virulence factor translocation. This contrasts with surface-exposed proteins like rOmpB, which has been well-characterized in its role mediating bacterial adherence to and invasion of non-phagocytic cells through interaction with host Ku70 receptor .

While RC0893 lacks the direct host cell interaction capabilities documented for proteins like rOmpA and rOmpB , its role in protein secretion may indirectly influence virulence factor deployment during infection processes.

What structural features of RC0893 are critical for its function in the protein secretion pathway?

The structural analysis of RC0893 should focus on:

  • Transmembrane Domain Analysis: Computational prediction and experimental validation of transmembrane helices through techniques like circular dichroism spectroscopy and hydropathy analysis.

  • Conserved Motif Identification: Multiple sequence alignment with YajC homologs across species to identify evolutionarily conserved residues that may be functionally significant.

  • Structure-Function Mapping: Targeted mutagenesis of conserved residues followed by functional complementation assays to identify regions essential for interaction with other translocon components.

  • Protein Dynamics Studies: Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify flexible regions that may facilitate protein-protein interactions within the secretion complex.

Understanding these structural elements provides insight into how RC0893 functions within the protein secretion machinery and potentially contributes to R. conorii pathogenesis through facilitating the translocation of virulence factors.

How does RC0893 compare to similar translocase proteins in other rickettsial species?

Comparative analysis of RC0893 homologs across rickettsial species reveals:

SpeciesProtein IDSequence Identity (%)Conserved Functional DomainsUnique Features
R. conorii (Reference)RC0893100%YajC domainPreprotein translocase function
R. rickettsiiA1G_05550~92%YajC domainSimilar membrane topology
R. prowazekiiRP521~87%YajC domainShorter N-terminal region
R. typhiRT0521~86%YajC domainAdditional cytoplasmic loop

Research approaches to investigate functional conservation should include:

  • Complementation Studies: Testing whether homologs from other rickettsial species can functionally substitute for RC0893 in R. conorii.

  • Evolutionary Analysis: Phylogenetic comparison to determine selective pressures acting on different regions of the protein across the rickettsial lineage.

  • Functional Domain Swapping: Creation of chimeric proteins to identify species-specific functional domains that may contribute to differences in protein secretion efficiency.

This comparative approach can reveal evolutionarily conserved mechanisms of protein secretion across rickettsial species while identifying adaptations specific to R. conorii.

What are the optimal conditions for purifying recombinant RC0893 while maintaining its native conformation?

Purification of RC0893 requires specialized approaches for membrane proteins:

  • Solubilization Optimization:

    • Initial screening of detergents using a panel approach (DDM, LDAO, Triton X-100, CHAPS)

    • Determination of critical micelle concentration (CMC) for each detergent

    • Optimization of detergent:protein ratios (typically 10:1 to 100:1)

  • Purification Protocol:

    • Immobilized metal affinity chromatography (IMAC) with extended washing steps

    • Size exclusion chromatography for separating protein-detergent complexes from empty micelles

    • Optional ion exchange chromatography step for removing contaminants

  • Stability Assessment:

    • Thermal shift assays modified for membrane proteins

    • Limited proteolysis to assess proper folding

    • Monitoring monodispersity through dynamic light scattering

  • Quality Control Metrics:

    • Purity assessment: >95% by SDS-PAGE

    • Monodispersity: PDI <0.2 by DLS

    • Functional validation through liposome reconstitution assays

This methodological approach ensures obtaining functionally relevant preparations of RC0893 suitable for downstream structural and functional studies.

What methodologies are most effective for studying RC0893 interactions with other components of the protein secretion machinery?

To characterize RC0893 interactions within the protein secretion complex:

  • Pull-down Assays: Using affinity-tagged RC0893 to identify interaction partners, followed by mass spectrometry identification of co-purifying proteins.

  • Crosslinking Mass Spectrometry: Chemical crosslinking of protein complexes followed by MS/MS analysis to identify interaction interfaces at residue-level resolution.

  • Förster Resonance Energy Transfer (FRET): Fusion of fluorescent protein pairs to RC0893 and potential partners to detect interactions in real-time within living bacteria.

  • Surface Plasmon Resonance (SPR): Quantitative measurement of binding kinetics between purified RC0893 and other components of the secretion machinery.

  • Bacterial Two-Hybrid Analysis: Systematic screening for protein-protein interactions using bacterial two-hybrid libraries to identify the complete interactome of RC0893.

These methodologies can elucidate how RC0893 functions as part of the preprotein translocase complex and potentially contributes to virulence factor secretion during R. conorii infection.

What approaches can be used to assess the contribution of RC0893 to R. conorii pathogenesis?

Evaluating RC0893's role in R. conorii pathogenesis requires multifaceted approaches:

  • Genetic Manipulation Strategies:

    • Conditional knockdown using antisense RNA or CRISPR interference

    • Complementation with wild-type or mutant variants

    • Overexpression studies to assess dosage effects

  • Functional Assays:

    • Protein secretion profiling through proteomics analysis of secreted fractions

    • Trafficking of known virulence factors using fluorescent fusion proteins

    • Assessment of bacterial fitness during infection

  • Host-Pathogen Interaction Models:

    • Mammalian cell invasion assays (comparing wild-type to RC0893-depleted strains)

    • Evaluation of intracellular replication kinetics

    • Assessment of host cell response alterations

While RC0893 does not appear to directly mediate host cell adhesion like rOmpA or rOmpB , its potential role in secreting proteins involved in intracellular survival and virulence could significantly impact pathogenesis.

What are the challenges and solutions for determining the structure of RC0893?

Membrane protein structural determination presents unique challenges:

  • Challenges Specific to RC0893:

    • Inner membrane localization requiring specialized solubilization methods

    • Potential conformational flexibility affecting crystallization

    • Relatively low abundance compared to outer membrane proteins

  • Methodological Solutions:

    • X-ray Crystallography Approach:

      • Lipidic cubic phase crystallization

      • Antibody fragment co-crystallization to stabilize flexible regions

      • Thermostability screening to identify stabilizing conditions

    • Cryo-EM Alternatives:

      • Reconstitution into nanodiscs to mimic native membrane environment

      • Single-particle analysis for structure determination without crystallization

      • Subtomogram averaging for in situ structural studies

    • NMR Approaches:

      • Solution NMR of isolated domains

      • Solid-state NMR of reconstituted full-length protein

  • Complementary Techniques:

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Electron paramagnetic resonance for distance measurements

    • Molecular dynamics simulations to model membrane integration

These approaches collectively address the technical challenges inherent in membrane protein structural biology while maximizing the likelihood of obtaining biologically relevant structural information about RC0893.

How can computational approaches complement experimental studies of RC0893?

Computational methods provide valuable insights when combined with experimental data:

  • Structural Prediction:

    • AlphaFold2 and RoseTTAFold modeling of RC0893 structure

    • Template-based modeling using homologous YajC structures

    • Membrane protein-specific refinement algorithms

  • Molecular Dynamics Simulations:

    • Insertion and stability in lipid bilayers

    • Conformational changes during interaction with other secretion components

    • Identification of water-accessible channels relevant to translocation function

  • Systems Biology Integration:

    • Network analysis of RC0893 in the context of R. conorii protein-protein interactions

    • Prediction of functional partners based on genomic context and co-expression data

    • Metabolic impact modeling based on secretion pathway alterations

  • Sequence-Based Analysis:

    • Evolutionary conservation mapping to identify functionally critical residues

    • Coevolution analysis to predict interaction interfaces

    • Identification of potential post-translational modification sites

These computational approaches provide testable hypotheses to guide experimental design while maximizing information extraction from limited experimental data on this challenging membrane protein.

How might targeting RC0893 affect the viability of R. conorii compared to other therapeutic targets?

Analysis of RC0893 as a potential therapeutic target reveals:

CharacteristicRC0893Other R. conorii Targets
DruggabilityNo Many classified as druggable (e.g., RC0333, RC0883)
EssentialityPotentially essential for protein secretionConfirmed essential for various metabolic pathways
ConservationHighly conserved across rickettsial speciesVariable conservation depending on target
AccessibilityInner membrane (limited accessibility)Surface exposed (higher accessibility)
FunctionProtein translocationVarious (cell wall synthesis, metabolism)

While RC0893 is not classified as druggable according to current analyses , targeting protein secretion systems remains a potentially valuable approach. The current therapeutic target landscape for R. conorii includes 39 druggable proteins out of the 88 non-homologous essential proteins identified , many involved in cell wall biosynthesis, lipopolysaccharide synthesis, and peptidoglycan synthesis.

Research strategies to assess RC0893 as an alternative target should include:

  • Conditional Knockout Studies: To determine the degree of essentiality under various conditions

  • Chemical Genetic Approaches: Using small molecule inhibitors of general secretion pathways

  • Combination Therapy Evaluation: Testing potential synergies between secretion inhibitors and conventional antibiotics

What are common pitfalls in recombinant expression of RC0893 and how can they be addressed?

Recombinant expression of membrane proteins like RC0893 presents specific challenges:

  • Toxicity to Expression Host:

    • Problem: Overexpression causing membrane stress and growth inhibition

    • Solution: Use of tightly regulated promoters (e.g., pBAD system) and lower induction temperatures

  • Inclusion Body Formation:

    • Problem: Improper folding leading to aggregation

    • Solution: Co-expression with chaperones (GroEL/ES, DnaK/J), reduced expression rates, and fusion to solubility-enhancing tags

  • Low Yield:

    • Problem: Insufficient protein production for downstream applications

    • Solution: Codon optimization, use of specialized strains (C41/C43), and high cell-density fermentation

  • Proteolytic Degradation:

    • Problem: Unstable protein subject to proteolysis

    • Solution: Addition of protease inhibitors, use of protease-deficient strains, and optimization of harvest timing

  • Verification Challenges:

    • Problem: Confirming proper folding and functionality

    • Solution: Development of activity assays specific to protein translocation function

Implementation of these solutions can significantly improve the success rate for obtaining functional recombinant RC0893 suitable for structural and functional studies.

How can researchers distinguish between direct and indirect effects when studying RC0893 function in R. conorii?

Distinguishing direct from indirect effects requires careful experimental design:

  • Acute vs. Chronic Depletion Studies:

    • Inducible knockdown systems to observe immediate effects (likely direct)

    • Comparison with long-term adaptation effects (potentially indirect)

  • Rescue Experiments:

    • Complementation with wild-type RC0893 should reverse direct effects

    • Domain-specific mutations can pinpoint functional regions

  • Temporal Analysis:

    • Time-course studies to establish causality and sequence of events

    • Pulse-chase experiments to track specific secreted proteins

  • Isolated System Reconstitution:

    • In vitro translocation assays with purified components

    • Liposome reconstitution to test direct protein function

  • Comparative Analysis Across Conditions:

    • Examining RC0893 function under various stress conditions

    • Comparison with phenotypes of other secretion system component mutations

These approaches collectively strengthen causal relationships between RC0893 and observed phenotypes, distinguishing its direct functions from downstream effects in the complex environment of R. conorii cellular systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.