Recombinant Rickettsia felis Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
lnt; RF_0576; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-496
Protein Length
full length protein
Species
Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)
Target Names
lnt
Target Protein Sequence
MYKPKIICLLLGMLSGLVFAPTFFIPALLTLSYLCYIVQKSENWQEAAKFGYLFGFGHFL SGIYWISIGVSVYIADFWWAIPFALFGLPIVLAFFISASCTLSFFAKNNKYYQFIFCICW VLFEWVRSWIFTGLPWNLIGYAFSFSDILIQTLSIIGIYGLSFIVIYISTSAYPLFRKQF TQLKILLASSVLILSVIVIYGAVRLSNNPTNFTDIKVRLVQPSIPQTEKWNEEEFWHNLM LHINLSENSEPTDLIIWSEAALIVPDDIPQVKSELLQMLNSTNAILITGGISDNKKQGDE FELYSAMYALDKNDHKLFEYHKSHLVPFGEYMPLKKILPFKKLTHGLIDYKEGDGGLVYL EKYNLKIKPLICYESIFPDFVRTNNEIVDVIINITNDAWYGKSSGPYQHFHISRSRAVEN GLPMIRVANNGISAIVDPFGRTIEKLNLNEINYTQGLIPKKLNSPTIFSQFGNFTILLLI VFILLINYLLALILDN
Uniprot No.

Target Background

Function
This protein catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, representing the final step in lipoprotein maturation.
Database Links

KEGG: rfe:RF_0576

STRING: 315456.RF_0576

Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rickettsia felis Apolipoprotein N-acyltransferase and what is its biological function?

Rickettsia felis Apolipoprotein N-acyltransferase (lnt) is an enzyme involved in the final step of lipoprotein maturation in bacteria. It catalyzes the N-acylation of apolipoproteins, transferring a fatty acid from a phospholipid to the N-terminal cysteine residue of prolipoproteins. This post-translational modification is essential for proper lipoprotein anchoring in the bacterial outer membrane.

In R. felis, a gram-negative obligate intracellular pathogen, lnt plays a crucial role in maintaining membrane integrity and function. The enzyme is encoded by the lnt gene (also designated as RF_0576) and produces a 496-amino acid protein with multiple transmembrane domains characteristic of membrane-bound acyltransferases . The protein's function is particularly significant since lipoproteins in R. felis likely contribute to bacterial survival within host cells and potentially to pathogenesis.

What is the molecular structure and key domains of R. felis lnt protein?

The full-length R. felis lnt protein consists of 496 amino acids with a molecular weight of approximately 55 kDa. The protein contains multiple hydrophobic regions forming transmembrane domains that anchor it to the bacterial inner membrane. Structural analysis predicts that R. felis lnt contains:

  • Multiple transmembrane helices, particularly concentrated in the N-terminal region

  • Conserved catalytic domains typical of membrane-bound O-acyltransferases

  • Substrate-binding regions necessary for interaction with both phospholipids and prolipoproteins

The amino acid sequence (MYKPKIICLLLGMLSGLVFAPTFFIPALLTLSYLCYIVQKSENWQEAAKFGYLFGFGHFLSGIYWISIGVSVYIADFWWAIPFALFGLPIVLAFFISASCTLSFFAKNNKYYQFIFCICWVLFEWVRSWIFTGLPWNLIGYAFSFSDILIQTLSIIGIYGLSFIVIYISTSAYPLFRKQFTQLKILLASSVLILSVIVIYGAVRLSNNPTNFTDIKVRLVQPSIPQTEKWNEEEFWHNLMLHINLSENSEPTDLIIWSEAALIVPDDIPQVKSELLQMLNSTNAILITGGISDNKKQGDEFELYSAMYALDKNDHKLFEYHKSHLVPFGEYMPLKKILPFKKLTHGLIDYKEGDGGLVYLEKYNLKIKPLICYESIFPDFVRTNNEIVDVIINITNDAWYGKSSGPYQHFHISRSRAVENGLPMIRVANNGISAIVDPFGRTIEKLNLNEINYTQGLIPKKLNSPTIFSQFGNFTILLLIVFILLINYLLALILDN) reveals features consistent with its membrane localization and enzymatic function .

How does R. felis lnt compare with homologous enzymes in other bacterial species?

  • R. felis lnt shows significant homology with other alpha-proteobacterial lnt proteins but has evolved specific adaptations reflecting its obligate intracellular lifestyle.

  • While the catalytic mechanism is conserved, R. felis lnt may have substrate preferences adapted to the unique phospholipid composition of rickettsial membranes.

  • Unlike free-living bacteria where lnt mutation often results in severe growth defects, the role of lnt in obligate intracellular pathogens like R. felis may be even more critical due to their highly adapted genomes and limited metabolic redundancy.

Comparative genomic analyses place R. felis within the spotted fever group (SFG) of rickettsiae , suggesting that its lnt likely shares more features with SFG rickettsial species than with typhus group members, despite early observations of R. felis having affinity to R. typhi based on immunofluorescence assays .

What expression systems are optimal for producing recombinant R. felis lnt protein?

Escherichia coli represents the most commonly used expression system for recombinant R. felis lnt protein production, as documented in the available literature . When selecting an expression system, researchers should consider:

  • E. coli expression provides several advantages:

    • High protein yield

    • Well-established protocols

    • Compatibility with His-tagging for purification

    • Cost-effectiveness for research applications

  • Expression vector selection considerations:

    • pET series vectors with T7 promoters offer strong inducible expression

    • Codon optimization may improve expression efficiency

    • Fusion partners may enhance solubility (His-tag being the most common)

  • Host strain selection factors:

    • BL21(DE3) and derivatives are preferred for membrane protein expression

    • C41/C43 strains may better accommodate potentially toxic membrane proteins

    • Rosetta strains provide rare codons that might be present in R. felis genes

While E. coli is the predominant system, researchers working with functional studies might consider eukaryotic expression systems that better represent the natural host environment of R. felis, which infects mammalian cells and arthropod vectors.

What are the optimal conditions for solubilizing and purifying recombinant R. felis lnt?

Purification of recombinant R. felis lnt presents challenges due to its multiple transmembrane domains. Based on available information and protocols for similar membrane proteins:

  • Solubilization optimization:

    • Mild detergents like n-dodecyl-β-D-maltoside (DDM) or CHAPS are recommended for initial solubilization

    • Detergent screening is advisable to determine optimal solubilization while maintaining protein activity

    • Solubilization should be performed at 4°C to prevent protein degradation

  • Purification protocol:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective for His-tagged constructs

    • Buffer composition should maintain protein stability (typically Tris/PBS-based buffer, pH 8.0)

    • Addition of glycerol (5-50%) helps maintain stability during storage

  • Post-purification handling:

    • Lyophilization can be used for long-term storage

    • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL is recommended

    • Aliquoting with addition of glycerol (final concentration of 50%) and storage at -20°C/-80°C prevents repeated freeze-thaw cycles

The purified protein should achieve >90% purity as determined by SDS-PAGE analysis .

What quality control methods are essential for verifying recombinant R. felis lnt integrity?

To ensure the integrity and functionality of purified recombinant R. felis lnt, the following quality control methods are recommended:

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (target: >90% purity)

    • Western blotting using anti-His antibodies to confirm the presence of the tagged protein

    • Size exclusion chromatography to assess protein homogeneity

  • Structural integrity verification:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Tryptophan fluorescence spectroscopy to assess tertiary structure

    • Thermal shift assays to determine protein stability

  • Functional validation:

    • In vitro enzymatic activity assays using synthetic substrates

    • Mass spectrometry to confirm post-translational modifications and protein mass

    • Limited proteolysis to assess proper folding

These methods provide complementary information about the quality of the recombinant protein and should be selected based on the intended application of the protein in downstream experiments.

How can recombinant R. felis lnt be used for antibody production and immunological studies?

Recombinant R. felis lnt presents a valuable tool for raising specific antibodies and conducting immunological investigations:

  • Antibody production strategy:

    • The full-length protein (496 amino acids) provides numerous epitopes for antibody recognition

    • Both polyclonal and monoclonal antibody approaches can be employed

    • Consideration should be given to potential cross-reactivity with homologous proteins from related species

  • Immunization protocols:

    • Initial immunization with 50-100 μg of purified protein in complete Freund's adjuvant

    • Boost immunizations (2-3) with 25-50 μg protein in incomplete Freund's adjuvant

    • ELISA screening to monitor antibody titers

    • Affinity purification of antibodies using immobilized recombinant protein

  • Applications in rickettsial research:

    • Immunofluorescence assays for detection of R. felis in clinical or environmental samples

    • Western blot detection of native lnt expression in R. felis

    • Immunoprecipitation studies to identify interaction partners

    • Neutralization assays to assess the role of lnt in infection

Researchers should note that while immunofluorescence is considered a reference method for diagnosis of rickettsial infection , cross-reactivity between species within the same group and sometimes between groups is common . Therefore, complementary methods should be employed for species confirmation.

What enzymatic assays can be developed to study R. felis lnt activity in vitro?

Development of enzymatic assays for R. felis lnt activity requires consideration of its membrane-bound nature and specialized function. The following approaches are recommended:

  • Substrate preparation:

    • Synthetic peptides mimicking the N-terminal region of R. felis prolipoproteins

    • Phospholipid substrates extracted from bacteria or synthetic analogs

    • Fluorescently labeled or radioactively tagged substrates for detection

  • Assay formats:

    • Detergent-solubilized enzyme assays in micelles

    • Liposome-reconstituted enzyme assays

    • Thin-layer chromatography (TLC) for reaction product separation

    • Mass spectrometry to detect N-acylation of substrate peptides

  • Activity quantification:

    • HPLC analysis of reaction products

    • Fluorescence-based continuous assays if using labeled substrates

    • Coupled enzyme assays that link lnt activity to a detectable signal

When developing these assays, researchers should carefully control for spontaneous acylation and ensure that detergents used do not interfere with the enzymatic reaction or detection methods.

How can recombinant R. felis lnt contribute to structural biology studies?

Structural characterization of R. felis lnt would significantly advance understanding of its function and potential as a therapeutic target. The following approaches are relevant:

  • Crystallography preparation:

    • Detergent screening to identify conditions maintaining protein stability and monodispersity

    • Surface entropy reduction through targeted mutations to enhance crystallization propensity

    • Lipidic cubic phase (LCP) crystallization trials, which are often successful for membrane proteins

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for high-resolution structure determination

    • Reconstitution into nanodiscs to maintain native-like lipid environment

    • Sample preparation optimization for membrane proteins

  • Computational structural biology:

    • Homology modeling based on related bacterial lnt structures

    • Molecular dynamics simulations to study conformational dynamics

    • Docking studies to predict substrate binding and inhibitor interactions

Structural information would provide invaluable insights into the catalytic mechanism of R. felis lnt and potential differences from other bacterial homologs that could be exploited for selective inhibition.

What is the significance of lnt in R. felis pathogenesis and life cycle?

Understanding the role of lnt in R. felis pathogenesis requires contextualizing its function within rickettsial biology:

  • Membrane integrity and survival:

    • Properly processed lipoproteins are essential for maintaining bacterial membrane structure

    • lnt-mediated lipoprotein maturation likely contributes to survival within host cells

    • Disruption of lnt function could potentially compromise bacterial viability

  • Host-pathogen interactions:

    • Bacterial lipoproteins often serve as pathogen-associated molecular patterns (PAMPs)

    • Mature lipoproteins may modulate host immune responses during infection

    • lnt-processed proteins might participate in adhesion, invasion, or intracellular trafficking

  • Vector colonization:

    • R. felis primarily infects cat fleas (Ctenocephalides felis)

    • lnt-dependent membrane proteins may facilitate survival in the arthropod vector

    • Temperature-dependent regulation of lnt activity could support adaptation to different hosts

The obligate intracellular lifestyle of R. felis suggests that lnt is likely essential for viability, similar to other intracellular bacteria with reduced genomes where most remaining genes serve critical functions.

How does R. felis lnt compare among different clinical isolates and strains?

Analysis of lnt sequence conservation and variation among R. felis isolates provides insights into its evolutionary pressure and functional importance:

  • Sequence conservation:

    • High conservation of catalytic residues would indicate functional constraints

    • Variation in non-catalytic regions might reflect adaptation to different hosts

    • Comparison between flea-derived and human-derived isolates could reveal host-specific adaptations

  • Geographical distribution considerations:

    • R. felis has been reported in 18 countries across all continents

    • Potential geographic variation in lnt sequences may exist but has not been extensively characterized

    • Strain differences might influence virulence or host preference

  • Evolutionary analysis:

    • Comparison with other rickettsial species provides evolutionary context

    • Horizontal gene transfer events, which have been documented in R. felis , might influence lnt evolution

    • Selection pressure analysis can identify regions under positive or purifying selection

These comparative analyses could identify conserved regions suitable for diagnostic test development or reveal strain-specific variations relevant to pathogenesis studies.

What detection methods exist for identifying R. felis lnt in clinical and research samples?

Detection of R. felis lnt in various sample types leverages molecular and immunological approaches:

  • PCR-based detection methods:

    • Conventional PCR targeting the lnt gene

    • Nested PCR for increased sensitivity in clinical samples

    • Quantitative real-time PCR for quantification

    • Species-specific primers can differentiate R. felis from other rickettsial species

  • Protein detection methods:

    • Western blotting using antibodies against recombinant lnt

    • Immunofluorescence assays for detecting lnt in fixed samples

    • Mass spectrometry-based proteomics for identification in complex samples

  • Detection in various sample types:

    • Arthropod vectors (fleas), where bacterial load is typically higher

    • Blood or serum samples from patients with suspected infection

    • Tissue culture systems used for R. felis propagation

The table below summarizes recommended detection approaches for different sample types:

Sample TypeRecommended Primary MethodAlternative MethodsSensitivity Considerations
Arthropod vectorsqPCR targeting lntNested PCR, IF assayHigh sensitivity due to bacterial load
Blood/serumNested PCRqPCR, serologyLow bacterial DNA concentration
Tissue cultureIF assayWestern blot, qPCRVariable expression levels
Clinical tissuesqPCRIF assay, IHCSample preservation critical

While these methods are theoretically applicable to lnt detection, it's worth noting that current R. felis detection in clinical settings more commonly targets other genes such as gltA, ompB, and htrA (17 kDa protein) .

How can R. felis lnt be targeted for antimicrobial development?

The essential nature of lnt for bacterial viability makes it a potential target for novel antimicrobial development:

  • Inhibitor design strategy:

    • Structure-based design targeting the catalytic site

    • High-throughput screening of compound libraries

    • Peptidomimetic approaches mimicking substrate intermediates

    • Fragment-based drug discovery to identify initial binding scaffolds

  • Target validation approaches:

    • Conditional knockdown of lnt in R. felis (if genetic manipulation is achievable)

    • In vitro inhibition studies correlating with growth inhibition

    • Specificity testing against mammalian enzymes to assess selectivity

  • Challenges in drug development:

    • Limited structural information on R. felis lnt

    • Membrane-localized target requiring lipophilic drugs

    • Delivery challenges into intracellular bacteria

    • Potential for resistance development

Development of lnt inhibitors would complement existing rickettsial treatments, which currently rely primarily on doxycycline and chloramphenicol as evidenced by clinical treatment reports .

What are the methodological challenges in studying R. felis lnt function in vivo?

Investigation of R. felis lnt function in living systems presents several technical challenges:

  • Genetic manipulation limitations:

    • R. felis is an obligate intracellular pathogen, complicating genetic manipulation

    • Limited genetic tools available for rickettsial species

    • Essential nature of lnt may prevent viable knockout mutants

  • In vivo study approaches:

    • Conditional expression systems or inducible knockdowns

    • Chemical genetics using specific inhibitors

    • Heterologous expression in model organisms

    • Transposon mutagenesis libraries with deep sequencing

  • Host cell and animal models:

    • XTC-2 and Vero cells (vertebrate) or ISE6 and C6/36 (arthropod) cell lines support R. felis growth

    • Flea infection models best represent natural vector environment

    • Mammalian models to study pathogenesis aspects

    • Cell-free systems for biochemical studies

Despite these challenges, creative approaches combining biochemical studies of the recombinant protein with cell culture models can provide valuable insights into lnt function.

How does temperature affect R. felis lnt expression and activity?

Temperature regulation is particularly relevant for R. felis, which transitions between arthropod vectors (ambient temperature) and mammalian hosts (higher temperature):

  • Expression temperature effects:

    • Recombinant protein expression in E. coli is typically conducted at lower temperatures (16-25°C) to enhance proper folding

    • Storage stability is optimized at -20°C/-80°C with glycerol as a cryoprotectant

    • Working concentrations are stable at 4°C for up to one week

  • Enzymatic activity considerations:

    • Temperature-dependent enzymatic activity may reflect adaptation to different host environments

    • Thermal stability assays can determine the temperature range for optimal activity

    • Temperature shifts might trigger differential regulation of lnt expression in vivo

  • Experimental design implications:

    • Studies comparing activity at different temperatures (e.g., 25°C vs. 37°C) may reveal host-specific adaptations

    • Temperature cycling experiments could simulate vector-to-host transmission

    • Protein stability should be monitored during temperature shift experiments

Understanding temperature effects on lnt function may provide insights into R. felis adaptation during its life cycle between arthropod vectors and mammalian hosts.

What emerging technologies could advance R. felis lnt research?

Several cutting-edge technologies hold promise for deepening our understanding of R. felis lnt:

  • Advanced structural biology approaches:

    • Cryo-electron tomography for visualizing lnt in its native membrane environment

    • Micro-electron diffraction (MicroED) for structure determination from small crystals

    • Integrative structural biology combining multiple experimental data types

  • Systems biology integration:

    • Multi-omics approaches connecting lnt function to global cellular processes

    • Metabolic labeling to track lipoprotein maturation pathways

    • Interactome mapping to identify lnt binding partners and substrates

  • Novel research tools:

    • CRISPR interference for conditional knockdown in rickettsial species

    • Nanobodies or aptamers as specific inhibitors for functional studies

    • Microfluidic systems for studying host-pathogen interactions at single-cell resolution

These technologies could overcome current limitations in studying this challenging pathogen and its essential enzymes.

How might R. felis lnt research contribute to understanding broader rickettsial biology?

Research on R. felis lnt has implications beyond this specific protein:

  • Comparative rickettsiology:

    • Insights into conserved mechanisms across rickettsial species

    • Understanding of adaptation mechanisms in different host environments

    • Identification of core essential functions versus accessory adaptations

  • Evolution of pathogenesis:

    • R. felis occupies an interesting position within rickettsial phylogeny, with some genes placing it in the SFG clade while showing affinity to typhus group in other aspects

    • Studies of lnt could illuminate evolutionary pressures on membrane protein processing

    • Horizontal gene transfer events involving lnt or its substrates might reveal adaptation mechanisms

  • Broader implications:

    • Model for studying membrane biogenesis in intracellular pathogens

    • Parallels with other vector-borne pathogens facing similar host transitions

    • Potential for identifying conserved targets for pan-rickettsial therapeutics

These broader implications position R. felis lnt research as a valuable contributor to understanding intracellular bacterial pathogens more generally.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.