Recombinant Rickettsia felis DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rickettsia felis DNA Translocase FtsK

FtsK is a crucial protein in bacterial cell division and chromosome segregation, particularly well-studied in Escherichia coli. It functions as a double-stranded DNA translocase, converting ATP hydrolysis energy into DNA movement, facilitating cytokinesis and chromosome segregation . Given the absence of specific data on Recombinant Rickettsia felis DNA translocase FtsK, we will focus on the general properties of FtsK and speculate on its potential role in Rickettsia felis.

Structure and Function

FtsK is composed of three main domains: N, L, and C. The C-terminal domain acts as a DNA translocase, crucial for chromosome segregation and cell division . The α and β subdomains form a hexameric ring that translocates DNA through ATP hydrolysis, while the γ domain controls directionality and attachment to DNA .

Role in Bacterial Cell Division

FtsK plays a pivotal role in bacterial cell division by ensuring proper chromosome segregation. It interacts with the XerCD recombination system to resolve chromosome dimers at the replication terminus .

Potential Implications for Rickettsia felis

Rickettsia felis is an obligate intracellular bacterium causing spotted fever in humans . While there is no specific information on FtsK in Rickettsia felis, understanding its role in other bacteria can provide insights into potential functions in this species.

Research Findings and Data

Currently, there are no specific research findings or data tables available for Recombinant Rickettsia felis DNA translocase FtsK. The following table summarizes general properties of FtsK based on studies in other bacteria:

PropertyDescription
FunctionDouble-stranded DNA translocase involved in bacterial cell division and chromosome segregation.
StructureComposed of N, L, and C domains; C domain includes α, β, and γ subdomains.
RoleEnsures proper chromosome segregation by interacting with XerCD recombination system.
SpeciesWell-studied in Escherichia coli; potential roles in other bacteria like Rickettsia felis are speculative.

References FtsK DNA translocase: the fast motor that knows where it's going. Activation of XerCD-dif recombination by the FtsK DNA translocase. Recombinant Full Length Staphylococcus Aureus Dna Translocase FtsK(FtsK) Protein, His-Tagged. FtsK - Wikipedia. The Genome Sequence of Rickettsia felis Identifies the First Putative Conjugative Plasmid Identified Among Obligate Intracellular Bacteria.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly specify them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery details, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your usage.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know and we will prioritize developing the specified tag.
Synonyms
ftsK; RF_1307; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-745
Protein Length
full length protein
Species
Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)
Target Names
ftsK
Target Protein Sequence
MLYYINKILSNNKVQAVILGIIGFAIVTVLTSYNIDDPSFNSVTTEYPSNLVGVFGSYLS DFLYQFFGLAAFIIPLACFVWSRNCWYGRYRGSFIRIFVMLLALISSSTLLSKIKLEFIP ANAGGAVGIIASNFFERFTNQLYLLLIFFTFIILVVLLEIKFTSLSNFIIKLGKFLIYRV QSFLHNIFSQLSSVRLFPTKNNDKINITSSYQKPVSEKVKFTEEAKPVPANPIKFFSKPP AVPKISQSEIAELPPISLLRDPENHNVKGASSSELKQKAEELLTVLNDFGVKGHIININQ GPVVTQYEFEPAAGTKTSRVVGLSDDIARSLSALSTRIAVIPGKNVLGIELPNKQREFFC LKELIETPEYQDKSTLLPLVLGKDLAGKPLIADLAKMPHLLVAGTTGSGKSVGINAMIVS LLYRYTPEECRFIMIDPKMLELSAYDGIPHLLTPVVTEPSKAVVALKWAVKEMENRYRMM SNIGVKNIAGYNAKILEAVKENRVIERSIQTGFDPETGKPIYETVTMNMEKLPYIVVIVD EMADLMLVAGKDIEMLIQRLAQMARAAGIHIIMATQRPSVDVITGVIKANFPSRISFKVT SKIDSRTILGEQGSEQLLGMGDMLFMGNTSKISRVHGPFVNEAEIEKITEYLKETGTPEY ISAVTEQPEEDDSSIDIGDGTSDEVLYKKAVQIVRDERKSSISYIQRSLRIGYNKAANLV EKMEKEGIVSPPNHTGKREILLPER
Uniprot No.

Target Background

Function
FtsK is an essential cell division protein that plays a crucial role in coordinating cell division and chromosome segregation. The N-terminus is involved in the assembly of the cell division machinery. The C-terminus functions as a DNA motor that moves dsDNA in an ATP-dependent manner towards the *dif* recombination site, located within the replication terminus region. Translocation ceases specifically at Xer-dif sites, where FtsK interacts with the Xer recombinase, facilitating chromosome unlinking through recombination. FtsK orienting polar sequences (KOPS) guide the direction of DNA translocation. FtsK can remove proteins from DNA during translocation; however, translocation stops specifically at the XerCD-dif site, preventing the removal of XerC and XerD from *dif*.
Database Links

KEGG: rfe:RF_1307

STRING: 315456.RF_1307

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rickettsia felis DNA translocase FtsK and what is its role in bacterial cells?

Rickettsia felis DNA translocase FtsK is a multifunctional protein essential for bacterial cell division and chromosome segregation. In bacterial systems, FtsK serves as a DNA pump that actively translocates double-stranded DNA at impressive speeds of approximately 5 kb/s. Its primary function involves facilitating chromosome unlinking by activating XerCD site-specific recombination at the dif site, which is located in the replication terminus region of bacterial chromosomes. The recombination process is critical for resolving chromosome dimers that form during replication, ensuring proper chromosome segregation prior to cell division . In R. felis specifically, this protein shares functional similarities with FtsK proteins from other bacteria while exhibiting species-specific characteristics related to the unique biology of this intracellular pathogen that is maintained in cat fleas by vertical transmission .

How is recombinant Rickettsia felis FtsK typically expressed and purified for research purposes?

Recombinant Rickettsia felis DNA translocase FtsK is typically expressed in E. coli expression systems. The most common approach involves cloning the ftsK gene into an expression vector that allows for the addition of an N-terminal histidine tag, which facilitates subsequent purification using affinity chromatography techniques .

The expression protocol generally follows these steps:

  • Transformation of the expression construct into a suitable E. coli strain (typically BL21(DE3) or derivatives)

  • Culture of transformed cells in appropriate media with induction of protein expression (usually using IPTG for T7-based systems)

  • Cell harvesting and lysis to release the recombinant protein

  • Purification using nickel or cobalt affinity chromatography to capture the His-tagged protein

  • Further purification steps may include ion exchange chromatography or size exclusion chromatography

  • Quality assessment typically involves SDS-PAGE analysis, with expectations of >90% purity

The purified protein is often prepared as a lyophilized powder for long-term storage. When reconstituting the protein, it is recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (typically 50%) for storage at -20°C or -80°C .

What are the optimal conditions for storing and handling recombinant Rickettsia felis FtsK protein?

For optimal storage and handling of recombinant Rickettsia felis FtsK protein, researchers should follow these evidence-based protocols:

Storage FormRecommended ConditionsAdditional Notes
Lyophilized powder-20°C to -80°C upon receiptStable for extended periods in this form
Reconstituted protein4°C for up to one week (working aliquots)Avoid repeated freeze-thaw cycles
Long-term storage of reconstituted protein-20°C to -80°C in aliquotsAdd glycerol to 5-50% (typically 50%) final concentration

The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . When reconstituting the lyophilized protein, it is recommended to briefly centrifuge the vial before opening to bring the contents to the bottom. For optimal results, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

For experimental work, it's important to maintain the protein's native conformation by avoiding conditions that might lead to denaturation or aggregation. Researchers should minimize freeze-thaw cycles by preparing appropriately sized working aliquots before freezing the reconstituted protein .

How can researchers design assays to measure the DNA translocation activity of recombinant FtsK?

To measure the DNA translocation activity of recombinant FtsK, researchers can implement several methodological approaches:

  • In vitro DNA translocation assays: These typically utilize defined DNA substrates with specific markers or fluorescent labels that allow for the detection of FtsK-mediated DNA movement. The assay can be performed by:

    • Preparing linear DNA substrates with known sequences, potentially including recognition sites for FtsK directional movement

    • Incubating the DNA with purified FtsK protein in the presence of ATP

    • Monitoring the translocation using real-time fluorescence measurements or end-point analysis techniques

  • Triplex displacement assays: This technique uses DNA triplexes formed by oligonucleotides binding to specific sites on the DNA substrate. FtsK translocation displaces the triplex-forming oligonucleotide, which can be measured in real-time.

  • Single-molecule approaches: These advanced techniques allow for direct visualization of DNA translocation:

    • Tethered particle motion analysis

    • Magnetic tweezers experiments

    • Fluorescence microscopy with labeled FtsK and/or DNA substrates

The experimental setup should include controls to verify that the observed activity is ATP-dependent, as FtsK translocases require ATP hydrolysis to drive DNA movement at their characteristic speeds of approximately 5 kb/s . Additionally, researchers should consider testing different buffer conditions, ATP concentrations, and DNA substrate designs to optimize the assay for the R. felis FtsK protein.

What methods can be used to study the interaction between recombinant Rickettsia felis FtsK and XerCD recombination system?

To study the interaction between recombinant Rickettsia felis FtsK and the XerCD recombination system, researchers can employ several methodological approaches:

  • In vitro recombination assays: These assays can directly measure FtsK-activated XerCD recombination at dif sites:

    • Prepare DNA substrates containing dif sites

    • Incubate with purified FtsK, XerC, and XerD proteins

    • Analyze recombination products using gel electrophoresis or other DNA analysis techniques

    • Compare reactions with and without FtsK to demonstrate activation

  • Holliday junction formation analysis: Since FtsK activates XerD to generate Holliday junction intermediates that are then resolved by XerC , researchers can specifically design assays to detect these intermediates:

    • Use specialized gel electrophoresis conditions that can separate Holliday junctions from substrate DNA

    • Implement time-course experiments to track the formation and resolution of the junctions

  • Domain interaction studies: To specifically examine the role of the γ regulatory subdomain of FtsK in activating XerD:

    • Create constructs expressing only the γ subdomain

    • Test whether this isolated domain can activate XerCD-dif recombination in the absence of the translocase domain

    • Compare the topology of recombination products with those generated in the presence of the full-length FtsK

  • Pull-down assays and protein-protein interaction studies:

    • Utilize the His-tag on recombinant FtsK to perform pull-down experiments with XerC and XerD proteins

    • Employ techniques such as surface plasmon resonance or isothermal titration calorimetry to quantify binding affinities

    • Use cross-linking approaches followed by mass spectrometry to identify specific interaction interfaces

Each of these approaches provides different and complementary information about how Rickettsia felis FtsK interacts with and activates the XerCD recombination system, which is essential for understanding the molecular mechanisms of chromosome unlinking during bacterial cell division.

How does the structure and function of Rickettsia felis FtsK compare to FtsK proteins from other bacterial species?

Comparing Rickettsia felis FtsK to its homologs in other bacterial species reveals important evolutionary adaptations and functional conservation:

SpeciesFtsK Size (aa)Key Structural FeaturesFunctional Distinctions
Rickettsia felis745N-terminal membrane domain, linker region, C-terminal motor domain with γ subdomainAssociated with obligate intracellular lifestyle; potentially adapted for Rickettsia-specific chromosome architecture
Escherichia coli~1330Longer protein with more extensive N-terminal domainWell-characterized role in chromosome dimer resolution; extensively studied motor activity
Other Rickettsia spp.VariableGenerally conserved domainsSpecies-specific adaptations related to host-pathogen interactions

The comparison of FtsK proteins across species highlights several important research considerations:

  • Domain conservation: The C-terminal motor domain containing the ATPase activity is typically the most conserved region across species, reflecting its essential role in DNA translocation. The γ subdomain that activates XerD recombinase activity is also highly conserved .

  • Species-specific adaptations: Rickettsia felis, as an obligate intracellular pathogen, may have evolved specific adaptations in its FtsK protein to accommodate the constraints of intracellular replication within arthropod hosts . Researchers should consider how these adaptations might influence experimental design when working with the recombinant protein.

  • Functional conservation: Despite structural differences, the fundamental role of FtsK in activating XerCD-dif recombination appears to be conserved across diverse bacterial species. The protein's ability to pump dsDNA at high speeds (approximately 5 kb/s) and its role in chromosome unlinking are likely universal features .

When designing comparative studies, researchers should consider how differences in protein size and domain organization might affect experimental parameters such as expression conditions, protein solubility, and assay design. Additionally, sequence variation in the DNA recognition domains might influence the specificity of DNA binding and the efficiency of XerCD activation.

What experimental challenges might researchers encounter when studying the γ subdomain of Rickettsia felis FtsK in isolation?

Studying the γ subdomain of Rickettsia felis FtsK in isolation presents several experimental challenges that researchers should anticipate:

  • Expression and solubility issues: Small domains expressed in isolation often have folding problems or solubility issues. Researchers might need to:

    • Test multiple expression systems and conditions

    • Consider fusion partners to enhance solubility (e.g., MBP, SUMO, or GST tags)

    • Optimize buffer conditions to maintain solubility

  • Functional activity verification: Determining whether the isolated γ subdomain retains its native activity can be challenging. Evidence suggests that the γ subdomain can activate XerCD-dif recombination in the absence of the translocase domain , but this activation may result in topologically complex recombination products that would impair chromosome unlinking in vivo. Researchers should:

    • Design assays that can detect XerD activation directly

    • Compare activity of the isolated domain with that of the full-length protein

    • Assess the topology of recombination products using appropriate gel electrophoresis techniques

  • Structural integrity validation: Ensuring that the isolated domain folds correctly is essential. Methodological approaches include:

    • Circular dichroism spectroscopy to assess secondary structure

    • Nuclear magnetic resonance (NMR) for more detailed structural analysis

    • Limited proteolysis to test for well-folded domains resistant to digestion

  • Interaction studies complexities: When studying how the isolated γ subdomain interacts with XerD, researchers may encounter:

    • Weaker or altered binding affinities compared to the full-length protein

    • Different kinetics of activation

    • Challenges in detecting transient interactions

The research on E. coli FtsK provides important insights, showing that while the γ subdomain can activate XerCD-dif recombination in isolation, the coupling between translocation and activation is essential for ensuring that recombination products are topologically unlinked . This suggests that studies of the isolated domain should be interpreted with caution and complemented with investigations of the full-length protein.

How can researchers investigate the potential differences between the LSU strain of Rickettsia felis FtsK and other characterized strains?

Investigating potential differences between the LSU strain of Rickettsia felis FtsK and other characterized strains (such as the type strain Marseille-URRWXCal2/California 2 or the Pedreira strain) requires a multifaceted approach:

  • Comparative genomic analysis:

    • Sequence the ftsK gene from different R. felis strains

    • Identify single nucleotide polymorphisms (SNPs) or larger variations

    • Perform phylogenetic analysis to understand evolutionary relationships

    • Analyze selection pressure on different domains of the protein

  • Expression and functional characterization:

    • Express recombinant FtsK proteins from different strains using identical systems

    • Compare biochemical properties including:

      • ATPase activity rates

      • DNA binding affinities

      • DNA translocation speeds

      • Efficiency of XerCD activation

  • Cell biology approaches:

    • Study FtsK localization in different R. felis strains using immunofluorescence or other imaging techniques

    • Investigate cell division phenotypes that might relate to FtsK function

    • Utilize the ISE6 tick cell line, which has been successfully used for R. felis cultivation , for comparative studies

  • Host interaction studies:

    • Examine whether strain-specific differences in FtsK might relate to host adaptation

    • Consider the relationship between FtsK function and the vertical transmission of R. felis in cat fleas

    • Investigate potential interactions with host factors during infection

When designing these studies, researchers should consider that R. felis has been successfully cultured in various cell lines including Vero cells, XTC-2 cells, and the tick-derived ISE6 cell line . The availability of multiple cultivation systems offers opportunities for comparative studies under different growth conditions that might reveal strain-specific adaptations in FtsK function.

What are common challenges in expressing and purifying active recombinant Rickettsia felis FtsK, and how can they be addressed?

Researchers often encounter several challenges when expressing and purifying active recombinant Rickettsia felis FtsK. Here are common issues and methodological solutions:

  • Low expression levels:

    • Optimize codon usage for E. coli expression by using codon-optimized synthetic genes

    • Test different E. coli expression strains (BL21(DE3), Rosetta, Arctic Express)

    • Vary induction conditions (temperature, IPTG concentration, induction time)

    • Consider using stronger promoters or high-copy-number plasmids

  • Protein insolubility:

    • Lower the expression temperature (16-20°C) to slow protein synthesis and allow proper folding

    • Express the protein as separate domains rather than the full-length protein

    • Use solubility-enhancing fusion tags (SUMO, MBP, TrxA)

    • Add solubility enhancers to the growth medium (sorbitol, glycylglycine)

    • Test different cell lysis methods to minimize aggregation during extraction

  • Protein instability:

    • Include protease inhibitors during all purification steps

    • Optimize buffer conditions (pH, salt concentration, glycerol content)

    • Add stabilizing agents such as trehalose (6% is used in commercial preparations)

    • Maintain the protein at 4°C during purification procedures

  • Low activity after purification:

    • Ensure proper protein folding by including a refolding step if necessary

    • Verify the integrity of functional domains using limited proteolysis

    • Add essential cofactors (ATP, Mg²⁺) during purification and storage

    • Avoid multiple freeze-thaw cycles by preparing single-use aliquots

  • Tag interference with function:

    • Compare the activity of N-terminally and C-terminally tagged versions

    • Include a cleavable tag that can be removed after purification

    • Test tag-free purification methods if tag interference is suspected

When troubleshooting expression and purification procedures, a systematic approach is essential. Researchers should modify one parameter at a time and thoroughly document the effects on protein yield, purity, and activity. Additionally, activity assays should be performed at each step of optimization to ensure that the purification process preserves the functional integrity of the recombinant FtsK protein.

How can researchers optimize assays to detect the activation of XerD by the γ subdomain of FtsK?

Optimizing assays to detect the activation of XerD by the γ subdomain of FtsK requires careful consideration of multiple experimental parameters:

  • In vitro recombination assay optimization:

    • Design DNA substrates with properly spaced and oriented dif sites

    • Optimize the ratio of FtsK (or isolated γ subdomain) to XerCD proteins

    • Include appropriate controls:

      • Negative: Reaction without FtsK or γ subdomain

      • Positive: Well-characterized FtsK or γ subdomain from model organisms

      • Specificity: Non-specific DNA binding proteins

    • Develop a time-course analysis to capture the kinetics of XerD activation

  • Detection of Holliday junction intermediates:

    • Use specialized gel electrophoresis conditions (e.g., native PAGE with or without chloroquine)

    • Consider two-dimensional gel electrophoresis to separate different DNA topologies

    • Implement time-resolved experiments to capture transient intermediates

    • Apply nuclease protection assays to identify protein binding sites within the recombination complex

  • Biochemical analysis of XerD catalytic activation:

    • Develop assays that directly measure XerD catalytic activity (e.g., DNA cleavage assays)

    • Use FRET-based approaches to monitor conformational changes in XerD upon γ subdomain binding

    • Implement surface plasmon resonance to measure binding kinetics between the γ subdomain and XerD

  • Structural approaches:

    • Consider using protein crystallography or cryo-EM to visualize the interaction between the γ subdomain and XerD

    • Apply hydrogen-deuterium exchange mass spectrometry to identify interaction interfaces

    • Use cross-linking coupled with mass spectrometry to map proximity relationships

Research has shown that the γ subdomain of FtsK can activate XerCD-dif recombination even in the absence of the translocase domain, although this leads to topologically complex recombination products . This finding suggests that activation assays should include analysis of the topology of recombination products, which could be achieved through specialized gel electrophoresis techniques or electron microscopy of DNA products.

What strategies can be employed to study the coupling between FtsK translocation and activation of XerCD-dif recombination?

Investigating the coupling between FtsK translocation and activation of XerCD-dif recombination requires sophisticated experimental approaches that can track these coordinated processes:

  • Integrated in vitro systems:

    • Design DNA substrates with multiple features:

      • Directional KOPS (FtsK-orienting polar sequences) to guide translocation

      • Strategically positioned dif sites

      • Reporter elements to detect both translocation and recombination

    • Implement real-time methods to simultaneously monitor:

      • ATP hydrolysis (e.g., coupled enzymatic assays)

      • DNA translocation (e.g., FRET-based reporters)

      • XerCD-dif recombination (e.g., product formation)

  • Mutational analysis:

    • Create and characterize FtsK variants with:

      • Defects in ATPase activity (translocation deficient but γ-domain intact)

      • Alterations in the γ subdomain (translocation competent but activation deficient)

      • Linker modifications (to probe the physical coupling between domains)

    • Test these variants in coordinated translocation-activation assays

  • Topological analysis of recombination products:

    • Compare the topology of recombination products generated:

      • With full-length FtsK (coupled translocation-activation)

      • With isolated γ subdomain (activation without translocation)

      • With ATPase-deficient full-length FtsK

    • Analyze products using:

      • Two-dimensional gel electrophoresis

      • Electron microscopy

      • Specialized techniques for DNA topology analysis

  • Single-molecule approaches:

    • Develop assays that can visualize individual DNA molecules undergoing:

      • FtsK translocation

      • XerCD binding and activation

      • Holliday junction formation and resolution

    • Use techniques such as:

      • Total internal reflection fluorescence (TIRF) microscopy

      • Magnetic or optical tweezers

      • DNA curtains

Research has demonstrated that the coupling between FtsK translocation and activation is essential for ensuring that the products of recombination are topologically unlinked, which is critical for proper chromosome segregation . This suggests that experimental designs should specifically assess the topological state of recombination products under different conditions.

How might studies of Rickettsia felis FtsK contribute to our understanding of bacterial chromosome segregation mechanisms?

Studies of Rickettsia felis FtsK can provide unique insights into bacterial chromosome segregation mechanisms for several compelling reasons:

  • Evolutionary perspectives: As a member of the Rickettsiales order, R. felis represents an interesting evolutionary position for comparative studies:

    • Rickettsia species have undergone genome reduction as obligate intracellular pathogens

    • Comparison with FtsK from free-living bacteria can reveal core conserved functions versus adaptable features

    • Analysis of how essential chromosome segregation machinery has evolved in specialized intracellular niches

  • Host-pathogen interaction insights:

    • Understanding how chromosome segregation occurs in the context of host cell infection

    • Investigating whether the host environment influences FtsK function or regulation

    • Exploring potential interactions between FtsK-mediated processes and host cellular machinery

  • Specialized adaptations:

    • R. felis is maintained in cat fleas by vertical transmission , suggesting potential adaptations in chromosome segregation mechanisms

    • The protein may have unique features related to the challenges of replication within arthropod host cells

    • These adaptations could reveal new principles about how segregation machinery functions under different cellular constraints

  • Therapeutic target potential:

    • FtsK represents an essential bacterial function that could be targeted for antimicrobial development

    • Comparative studies of R. felis FtsK might reveal rickettsia-specific features that could be exploited

    • Understanding the mechanism may contribute to strategies for interfering with pathogen replication

The research demonstrating that FtsK translocation and activation of unlinking are normally coupled processes, with translocation being essential for ensuring topologically unlinked recombination products , has broad implications for understanding chromosome segregation across bacterial species. Investigation of whether and how R. felis FtsK achieves this coupling could provide valuable insights into both conserved mechanisms and species-specific adaptations.

What are the potential applications of recombinant Rickettsia felis FtsK in structural biology studies?

Recombinant Rickettsia felis FtsK offers several promising applications in structural biology studies:

To facilitate these structural studies, researchers might need to:

  • Express and purify individual domains separately

  • Create fusion constructs that stabilize flexible regions

  • Implement limited proteolysis to identify stable core domains

  • Develop co-expression systems for protein complexes

  • Optimize buffer conditions to promote crystal formation or suitable samples for cryo-EM

The availability of recombinant R. felis FtsK as a lyophilized powder with high purity (>90%) provides a starting point for structural biology investigations, though researchers may need to refine purification protocols to meet the specific requirements of different structural determination techniques.

How can researchers use recombinant Rickettsia felis FtsK to investigate potential antibacterial targets?

Recombinant Rickettsia felis FtsK provides researchers with valuable opportunities to investigate novel antibacterial targets:

  • High-throughput screening platforms:

    • Develop assays based on FtsK's ATPase activity that can be used to screen compound libraries

    • Design fluorescence-based DNA translocation assays suitable for screening inhibitors

    • Create XerCD activation assays to identify molecules that disrupt this essential interaction

    • Implement these screens in automated formats for large-scale compound testing

  • Structure-based drug design approaches:

    • Use structural data from recombinant FtsK to identify potential binding pockets

    • Conduct in silico screening of virtual compound libraries against these pockets

    • Design rational inhibitors based on the ATP binding site or interfaces with DNA or XerCD

    • Validate computational predictions using the recombinant protein in biochemical assays

  • Fragment-based drug discovery:

    • Screen small molecular fragments for binding to recombinant FtsK

    • Use techniques such as NMR, X-ray crystallography, or surface plasmon resonance

    • Develop fragment hits into lead compounds through medicinal chemistry

    • Test lead optimization using functional assays with the recombinant protein

  • Validation methodologies:

    • Confirm that identified inhibitors specifically target FtsK rather than having general effects

    • Test effects on:

      • ATPase activity

      • DNA binding and translocation

      • XerCD activation

      • Bacterial growth and division in culture systems

    • Assess activity against multiple bacterial species to determine spectrum

  • Cellular studies:

    • Test promising compounds in cell culture systems for R. felis, such as the ISE6 tick cell line

    • Examine effects on bacterial replication and chromosome segregation

    • Assess potential cytotoxicity to host cells

    • Investigate mechanisms of compound action in cellular contexts

Targeting FtsK represents a promising antibacterial strategy because its function is essential for bacterial chromosome segregation and cell division. The availability of recombinant Rickettsia felis FtsK provides researchers with a tool to investigate this target specifically in the context of rickettsial infections, which could lead to new approaches for combating these challenging pathogens.

What are the most important considerations for researchers planning to work with recombinant Rickettsia felis FtsK?

Researchers planning to work with recombinant Rickettsia felis FtsK should consider several critical factors to ensure successful experimental outcomes:

  • Protein quality and handling:

    • Ensure proper storage and reconstitution of the lyophilized protein

    • Avoid repeated freeze-thaw cycles by preparing appropriate aliquots

    • Consider the addition of stabilizing agents such as trehalose and glycerol

    • Verify protein activity after each major handling step

  • Experimental design factors:

    • Include appropriate positive and negative controls in all assays

    • Design experiments that can distinguish between different functional aspects (DNA binding, translocation, XerCD activation)

    • Consider the multidomain nature of the protein when interpreting results

    • Be aware that the addition of tags (such as the His-tag) may affect certain functions

  • Contextual understanding:

    • Appreciate the biological context of FtsK function in chromosome segregation

    • Consider how the obligate intracellular lifestyle of R. felis might influence protein function

    • Recognize the evolutionary relationships between FtsK proteins across bacterial species

    • Understand the coupling between translocation and activation of recombination

  • Technical expertise requirements:

    • Develop proficiency in protein biochemistry techniques

    • Establish reliable assays for measuring different aspects of FtsK function

    • Consider collaborations to access specialized equipment (e.g., for single-molecule studies)

    • Implement rigorous data analysis approaches appropriate for complex enzymatic activities

By carefully considering these factors, researchers can maximize the value of their work with recombinant Rickettsia felis FtsK and contribute meaningful insights to our understanding of this important bacterial translocase and its role in chromosome segregation mechanisms.

What future research directions might emerge from studies of recombinant Rickettsia felis FtsK?

Studies of recombinant Rickettsia felis FtsK are likely to inspire several promising future research directions:

  • Comparative genomics and evolution:

    • Comprehensive analysis of FtsK across Rickettsia species and strains

    • Investigation of selective pressures on different FtsK domains

    • Exploration of how FtsK coevolves with XerCD and dif sites

    • Understanding how genome reduction in obligate intracellular bacteria affects chromosome segregation machinery

  • Systems biology approaches:

    • Integration of FtsK function into models of bacterial cell division

    • Network analysis of protein interactions involving FtsK

    • Investigation of regulatory mechanisms controlling FtsK expression and activity

    • Computational modeling of chromosome segregation dynamics

  • Advanced imaging technologies:

    • Development of methods to visualize FtsK localization and function in living Rickettsia

    • Single-molecule tracking of FtsK movement during chromosome segregation

    • Super-resolution microscopy of FtsK-DNA complexes

    • 4D imaging of chromosome dynamics during bacterial division

  • Therapeutic applications:

    • Design of FtsK inhibitors as novel antibacterial agents

    • Development of assay platforms for high-throughput screening

    • Investigation of combination approaches targeting multiple cell division proteins

    • Exploration of species-specific inhibition strategies

  • Synthetic biology applications:

    • Engineering of FtsK variants with altered properties for biotechnology applications

    • Development of FtsK-based DNA manipulation tools

    • Creation of minimal synthetic systems to study chromosome segregation

    • Design of artificial chromosome partitioning systems based on FtsK principles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.