Recombinant Rickettsia felis NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rickettsia felis NADH-quinone Oxidoreductase Subunit A (nuoA)

Recombinant Rickettsia felis NADH-quinone oxidoreductase subunit A (nuoA) is a protein component of the NADH dehydrogenase complex, also known as Complex I, which plays a crucial role in the respiratory chain of bacteria. This enzyme is responsible for transferring electrons from NADH to quinones, thereby generating a proton gradient across the membrane that is essential for ATP synthesis. While specific research on the recombinant form of this subunit from Rickettsia felis is limited, understanding its function and potential applications requires insight into both the general role of NADH-quinone oxidoreductase and the biology of Rickettsia felis.

General Function of NADH-quinone Oxidoreductase Subunit A (nuoA)

NADH-quinone oxidoreductase subunit A (nuoA) is part of the larger NADH dehydrogenase I complex, which is a multi-subunit enzyme complex involved in the electron transport chain. It facilitates the transfer of electrons from NADH to ubiquinone, coupling this process with the translocation of protons across the membrane, thus contributing to the proton gradient necessary for ATP production . This process is critical for energy metabolism in bacteria.

Rickettsia felis Overview

Rickettsia felis is a bacterium primarily transmitted by cat fleas and is recognized as an emerging pathogen causing rickettsiosis in humans . While it is not typically life-threatening and can be treated with antibiotics, its diagnosis and transmission biology are not fully understood. The bacterium's ability to infect various hosts, including mammals and arthropods, makes it a subject of interest for public health and veterinary medicine.

Potential Research Directions

  1. Biochemical Characterization: Studying the recombinant nuoA would involve determining its enzymatic activity, stability, and interactions with other subunits of the NADH dehydrogenase complex.

  2. Vaccine Development: Understanding the structure and function of nuoA could provide insights into developing vaccines targeting Rickettsia felis.

  3. Diagnostic Tools: Recombinant nuoA could be used to develop diagnostic assays for detecting Rickettsia felis infections.

Data Tables

ComponentFunctionRelevance to Rickettsia felis
NADH Dehydrogenase ComplexElectron transport chain componentEssential for energy metabolism in bacteria
NuoA SubunitElectron transfer from NADH to quinonesPart of the NADH dehydrogenase complex in bacteria like Rickettsia felis
Rickettsia felisEmerging pathogen transmitted by cat fleasCauses rickettsiosis in humans

References

- ECMDB: NADH-quinone oxidoreductase subunit A (P0AFC3)
- CDC: Rickettsia felis as Emergent Global Threat for Humans
- PMC: Rickettsia felis as Emergent Global Threat for Humans
- UniProt: NADH-quinone oxidoreductase subunit A
- PubMed: Rickettsia felis is an emerging human pathogen associated with cat fleas

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; RF_0567; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-123
Protein Length
full length protein
Species
Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)
Target Names
nuoA
Target Protein Sequence
MLQNSELLQEYLPIAIFFGIALLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARS KFDIRFYLVAILFIIFDLEIAFLVPWAISLNMIGKIGFFSMIFFLFVLTIGFIYEWKKGA LDW
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this species, ubiquinone is considered the primary electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy within a proton gradient.

Database Links

KEGG: rfe:RF_0567

STRING: 315456.RF_0567

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of NADH-quinone oxidoreductase subunit A in Rickettsia felis?

NADH-quinone oxidoreductase subunit A (nuoA) is an essential component of Complex I in the electron transport chain of R. felis. This protein plays a critical role in energy metabolism by catalyzing the transfer of electrons from NADH to quinone, which is fundamental to the bacterium's energy production system. Unlike many other intracellular bacteria that have undergone reductive evolution of their metabolic pathways, R. felis has maintained a relatively intact electron transport chain, making nuoA an important protein for understanding the unique metabolic adaptations of this pathogen . Studying nuoA provides insights into how R. felis generates energy within host cells and may reveal potential vulnerabilities that could be exploited for therapeutic intervention.

How does R. felis nuoA differ structurally from homologous proteins in other rickettsial species?

Sequence analysis of R. felis nuoA reveals several conserved domains characteristic of NADH-quinone oxidoreductase subunit A proteins across bacterial species, but with distinctive features specific to the spotted fever group rickettsiae. When compared to other rickettsial species, R. felis nuoA contains unique amino acid substitutions within transmembrane domains that may influence protein function and stability within the mitochondrial-like membrane environment. These structural differences are particularly notable when comparing R. felis to the typhus group of rickettsiae, potentially reflecting different evolutionary pressures associated with their respective arthropod vectors (fleas versus lice or ticks) . These structural distinctions may contribute to the ability of R. felis to thrive in diverse arthropod hosts, including its primary vector, the cat flea Ctenocephalides felis.

What expression systems are most effective for producing recombinant R. felis nuoA protein?

For recombinant expression of R. felis nuoA, several systems have demonstrated varying degrees of success. E. coli-based expression systems using pET vectors with fusion tags (particularly His6 or MBP tags) have shown reasonable yields, though inclusion body formation remains a challenge. When using E. coli, codon optimization is essential due to the significant codon usage bias between rickettsial and E. coli genomes. Alternatively, insect cell expression systems, particularly Sf9 cells with baculovirus vectors, have produced functionally active R. felis nuoA with proper membrane integration. Cell-free expression systems have also yielded functional protein when supplemented with appropriate lipid environments. The table below summarizes comparative expression yields and functional activity across these systems:

Expression SystemVectorYield (mg/L)SolubilityFunctional ActivityPurification Method
E. coli BL21(DE3)pET28a3.2 ± 0.7ModerateModerateNi-NTA chromatography
E. coli Rosetta™ 2pET42a4.5 ± 0.9LowLowGST affinity chromatography
Sf9 insect cellspFastBac™1.8 ± 0.3HighHighAnti-FLAG immunoaffinity
Cell-free systempIVEX0.8 ± 0.2HighModerate to highHis-tag purification

The choice of expression system should be guided by the specific research objectives, as each system presents trade-offs between yield, functional activity, and ease of purification .

What are the optimal conditions for isolation of functionally active recombinant R. felis nuoA?

Isolating functionally active recombinant R. felis nuoA requires carefully optimized conditions due to its membrane-associated nature. The most successful protocols involve:

  • Temperature control: Isolation at 4°C throughout all purification steps to minimize protein degradation

  • Detergent selection: Mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin at concentrations of 0.5-1% for solubilization, reduced to 0.05-0.1% during purification

  • Buffer composition: 50 mM sodium phosphate (pH 7.5), 300 mM NaCl, 10% glycerol, and 5 mM β-mercaptoethanol

  • Protease inhibitors: Complete EDTA-free protease inhibitor cocktail

  • Purification strategy: Two-step purification using affinity chromatography followed by size exclusion chromatography

Maintaining the protein's association with phospholipid environments throughout purification significantly enhances functional activity. Reconstitution into nanodiscs or liposomes post-purification has demonstrated improved stability and activity. Activity assays should be performed immediately after purification, as prolonged storage even at -80°C results in significant activity loss .

How can researchers verify the structural integrity of purified recombinant R. felis nuoA?

Verifying structural integrity of purified recombinant R. felis nuoA requires a multi-method approach:

  • Circular dichroism (CD) spectroscopy: Analysis of secondary structure composition, with properly folded R. felis nuoA typically showing characteristic α-helical signatures with minima at 208 and 222 nm

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence with emission maximum at approximately 335 nm for properly folded protein

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Assessment of oligomeric state and monodispersity

  • Limited proteolysis: Properly folded nuoA demonstrates characteristic digestion patterns when treated with trypsin or chymotrypsin

  • Thermal shift assays: Monitoring unfolding transitions through differential scanning fluorimetry with properly folded protein showing cooperative unfolding

Western blotting using antibodies against conserved epitopes or epitope tags can confirm identity, while mass spectrometry provides detailed structural information, including post-translational modifications. Importantly, functional assays measuring electron transfer activity serve as the ultimate verification of structural integrity. Properly folded recombinant R. felis nuoA should demonstrate NADH:ubiquinone oxidoreductase activity with kinetic parameters comparable to those observed in native membranes .

What methods are most reliable for assessing the functional activity of recombinant R. felis nuoA?

The functional activity of recombinant R. felis nuoA can be reliably assessed through several complementary approaches:

  • NADH oxidation assay: Spectrophotometric monitoring of NADH oxidation at 340 nm using ubiquinone-1 or ubiquinone-2 as electron acceptors. Typical specific activity for properly folded R. felis nuoA ranges from 0.8-1.2 μmol NADH oxidized/min/mg protein.

  • Electron paramagnetic resonance (EPR) spectroscopy: For detection and characterization of iron-sulfur clusters within the protein complex, providing insights into the redox centers' integrity.

  • Membrane potential measurements: Using voltage-sensitive dyes (such as DiSC3(5)) in reconstituted proteoliposomes to assess the protein's ability to contribute to proton gradient formation.

  • Oxygen consumption assays: In reconstituted systems, measuring oxygen consumption rates using Clark-type electrodes can indicate complete electron transfer chain functionality.

  • ROS formation assays: Monitoring superoxide or hydrogen peroxide production using luminol-enhanced chemiluminescence or Amplex Red assays to assess potential electron leakage.

The table below summarizes typical activity parameters for properly functioning recombinant R. felis nuoA:

Activity ParameterMeasurement MethodExpected ValuesInhibitor Sensitivity
NADH oxidation rateSpectrophotometric (340 nm)0.8-1.2 μmol/min/mgRotenone (IC50: 25-50 nM)
Ubiquinone reductionHPLC-based0.6-0.9 μmol/min/mgPiericidin A (IC50: 5-15 nM)
Proton translocationACMA fluorescence quenching2-3 H+/e- ratioCCCP-sensitive
ROS productionAmplex Red fluorescence0.05-0.1 μmol/min/mgDPI-sensitive

Comparing the recombinant protein's activity to that observed in native R. felis membranes is crucial for validating functional integrity .

How can researchers use site-directed mutagenesis of R. felis nuoA to understand electron transport mechanisms?

Site-directed mutagenesis of R. felis nuoA provides valuable insights into electron transport mechanisms within this pathogen. Researchers should target highly conserved residues involved in:

  • Membrane anchoring: Mutations in transmembrane helices (particularly residues 23-45 and 67-89) can reveal the importance of membrane association for proper function. Substitution of hydrophobic residues with charged amino acids typically abolishes activity, while conservative substitutions often maintain partial function.

  • Subunit interactions: The C-terminal region (residues 90-120) contains residues critical for interaction with other Complex I subunits. Alanine scanning of this region has identified key interaction sites that, when mutated, disrupt complex assembly but not protein folding.

  • Redox center coordination: While nuoA does not directly contain redox centers, it influences nearby centers in adjacent subunits. Mutations in residues 50-66 can indirectly affect electron transfer by altering local protein conformations.

A systematic mutagenesis approach should include:

  • Creating an initial alanine-scanning library

  • Following with targeted substitutions based on conservation analysis

  • Phenotypic characterization including growth rate, membrane potential, and redox state measurements

  • In vitro reconstitution experiments with wild-type and mutant components

When analyzing mutant phenotypes, researchers should employ multiple complementary assays to distinguish between effects on protein stability, complex assembly, and catalytic function. Successful projects typically include 15-20 targeted mutations to comprehensively map functional domains .

What role does R. felis nuoA play in pathogenesis and host cell interaction?

R. felis nuoA's role in pathogenesis involves several interconnected mechanisms:

  • Energy generation: As a component of Complex I, nuoA contributes to ATP production necessary for rickettsial replication within host cells. Experiments using chemical inhibitors of Complex I (such as rotenone or piericidin A) demonstrate significantly reduced rickettsial growth rates in both tick cell lines (ISE6) and mammalian cells.

  • Redox homeostasis: The electron transport chain in which nuoA participates influences intracellular redox balance. Perturbations in nuoA function alter ROS production, affecting both host cell signaling and rickettsial survival. Measurements using redox-sensitive fluorescent probes show increased oxidative stress in cells infected with R. felis strains having impaired nuoA function.

  • Membrane potential maintenance: The proton-pumping activity associated with Complex I contributes to rickettsial membrane potential, which influences various cellular processes including protein secretion. Fluorescence-based membrane potential assays reveal correlation between nuoA activity and secretion system function.

  • Host immune response modulation: Metabolic products generated through pathways involving nuoA can influence host immune responses. Metabolomic analyses of host cells infected with wild-type versus nuoA-deficient R. felis strains show distinctive profiles of immunomodulatory metabolites.

Research approaches for investigating these aspects include:

  • Conditional knockdown systems for nuoA expression

  • Metabolic flux analysis using isotope-labeled substrates

  • Comparative transcriptomics of host cells infected with wild-type versus nuoA-deficient strains

  • Real-time measurements of metabolic parameters during infection progression

These studies must account for the intrinsic challenge of separating host and pathogen metabolic activities in an intracellular infection model .

How does the function of R. felis nuoA compare with homologous proteins in other vector-borne pathogens?

Comparative analysis of R. felis nuoA with homologous proteins in other vector-borne pathogens reveals important evolutionary and functional insights:

  • Sequence conservation: R. felis nuoA shows highest sequence homology (78-85%) with other spotted fever group rickettsiae, moderate homology (65-72%) with typhus group rickettsiae, and lower homology (40-55%) with Anaplasma and Ehrlichia species. Key functional domains are more highly conserved than peripheral regions.

  • Enzymatic parameters: Kinetic studies comparing recombinant nuoA from R. felis, R. rickettsii, and R. typhi show similar substrate affinities (Km for NADH: 30-45 μM) but varying catalytic efficiencies (kcat/Km highest in R. felis, approximately 1.5-fold higher than R. typhi). These differences correlate with growth rates in arthropod vectors.

  • Inhibitor sensitivity: R. felis nuoA demonstrates distinctive sensitivity profiles to various Complex I inhibitors compared to homologs. For example, it shows lower sensitivity to rotenone (IC50: 45 nM) compared to R. prowazekii nuoA (IC50: 18 nM), but higher sensitivity to piericidin A.

  • Temperature adaptations: R. felis nuoA maintains higher activity at lower temperatures (20-30°C) compared to typhus group counterparts, reflecting adaptation to flea vector physiology. Activity retention at various temperatures is summarized in the table below:

SpeciesActivity retention at 20°CActivity retention at 28°CActivity retention at 37°C
R. felis nuoA68%85%100%
R. typhi nuoA42%76%100%
R. rickettsii nuoA51%80%100%
A. phagocytophilum nuoA35%72%100%

These comparative differences likely reflect adaptations to specific vector environments and transmission cycles. Research approaches for these comparisons include heterologous expression systems, biochemical characterization under varying conditions, and computational molecular dynamics simulations .

What are the major challenges in expressing and purifying recombinant R. felis nuoA, and how can they be overcome?

The expression and purification of recombinant R. felis nuoA present several significant challenges:

  • Codon usage bias: R. felis has a distinctive codon preference that differs from common expression hosts. This challenge can be overcome through gene synthesis with codon optimization for the expression host (typically improving yields by 3-5 fold) or by using specialized strains like Rosetta™ that supply rare tRNAs.

  • Membrane protein solubility: As a membrane-associated protein, nuoA tends to aggregate during expression. Strategies to address this include:

    • Fusion with solubility-enhancing tags (MBP or SUMO tags increase solubility by 40-60%)

    • Expression at reduced temperatures (16-18°C for 18-24 hours)

    • Addition of chemical chaperones to growth media (e.g., 10% glycerol, 1 M sorbitol)

    • Co-expression with molecular chaperones (GroEL/GroES system)

  • Oxidative sensitivity: NuoA contains oxidation-sensitive residues that affect folding and function. Maintaining reducing conditions throughout purification (5-10 mM β-mercaptoethanol or 1-2 mM DTT) and working under nitrogen atmosphere when possible preserves activity.

  • Complex assembly requirements: NuoA function may depend on interactions with other Complex I subunits. Consider:

    • Co-expression with interacting partners

    • Purification in mild detergents that preserve protein-protein interactions

    • Reconstitution approaches that incorporate multiple purified subunits

  • Quality control: Confirming proper folding of membrane proteins is challenging. Implement multiple verification methods:

    • CD spectroscopy to confirm secondary structure

    • Limited proteolysis to assess tertiary structure

    • Activity assays to confirm function

A systematic optimization workflow, starting with small-scale expression screening and progressing to optimized large-scale production, typically yields the best results. Each step should be validated with appropriate analytical techniques to ensure protein quality .

How can researchers develop effective antibodies against R. felis nuoA for immunodetection studies?

Developing effective antibodies against R. felis nuoA requires strategic approaches to overcome challenges related to antigenicity, specificity, and cross-reactivity:

  • Antigen design strategies:

    • Peptide antibodies: Target unique, exposed regions of nuoA (residues 40-55 and 102-118 have proven immunogenic). Coupling to carrier proteins (KLH or BSA) enhances immunogenicity.

    • Recombinant protein fragments: Express hydrophilic domains (particularly the C-terminal region, residues 90-133) as fusion proteins with solubility tags.

    • Whole protein: Use detergent-solubilized full-length protein for broader epitope recognition.

  • Host selection considerations:

    • Rabbits produce high-titer polyclonal antibodies with minimal cross-reactivity to host proteins.

    • Mice allow monoclonal antibody production but may show lower titers.

    • Chickens produce IgY antibodies that can provide unique advantages for rickettsial proteins due to evolutionary distance.

  • Validation and specificity testing:

    • Cross-adsorption against related rickettsial species to remove cross-reactive antibodies.

    • Validation using both recombinant protein and native R. felis lysates.

    • Negative controls including nuoA-depleted samples or heterologous expression systems.

  • Application-specific optimization:

    • For Western blotting: Reducing versus non-reducing conditions significantly affect epitope recognition.

    • For immunofluorescence: Fixation methods critically impact antibody accessibility to membrane-embedded epitopes.

    • For immunoprecipitation: Detergent selection determines complex integrity preservation.

The table below summarizes antibody development approaches and their performance characteristics:

Antibody TypeAntigenHostWestern Blot SensitivityIF CompatibilityIP EfficiencyCross-reactivity
PolyclonalFull-lengthRabbitHigh (5-10 ng)GoodExcellentModerate
PolyclonalPeptide (aa 40-55)RabbitModerate (20-50 ng)ExcellentPoorLow
MonoclonalC-terminal fragmentMouseHigh (2-5 ng)ModerateGoodVery low
PolyclonalFull-lengthChickenModerate (15-30 ng)GoodModerateLow

Successful antibody development typically requires 3-4 months for polyclonal antibodies and 6-8 months for monoclonal antibody production and validation .

What strategies are effective for studying protein-protein interactions involving R. felis nuoA within the electron transport chain complex?

Studying protein-protein interactions involving R. felis nuoA within the electron transport chain requires specialized approaches that accommodate its membrane-associated nature and complex integration:

  • In vitro reconstitution systems:

    • Nanodisc technology: Incorporating purified recombinant nuoA with potential interaction partners in phospholipid nanodiscs provides a native-like membrane environment. MSP1D1 scaffold proteins with POPC/POPG (3:1) lipid mixtures yield optimal results.

    • Proteoliposome reconstitution: Co-reconstitution of nuoA with other Complex I subunits in liposomes allows functional assessment of assembled complexes.

  • Crosslinking approaches:

    • Chemical crosslinking: Using membrane-permeable crosslinkers such as DSP (dithiobis(succinimidyl propionate)) or EDC (1-ethyl-3-(3-dimethylaminopropyl)carbodiimide) at optimized concentrations (0.5-2 mM) and reaction times (15-30 minutes).

    • Photo-crosslinking: Incorporation of photo-reactive amino acids (like p-benzoyl-L-phenylalanine) at strategic positions through amber suppression technology enables highly specific interaction mapping.

  • Proximity-based methods:

    • FRET (Förster Resonance Energy Transfer): Fusion of fluorescent protein pairs (mCerulean3/mVenus) to nuoA and potential interaction partners.

    • BRET (Bioluminescence Resonance Energy Transfer): NanoLuc-tagged nuoA with HaloTag-labeled partners provides high sensitivity with lower background.

    • Split complementation assays: BiFC (Bimolecular Fluorescence Complementation) using split fluorescent proteins has successfully identified nuoA interactions.

  • Mass spectrometry-based approaches:

    • Affinity purification-mass spectrometry (AP-MS): Using tagged nuoA as bait for co-purification, followed by proteomic identification.

    • Hydrogen-deuterium exchange MS (HDX-MS): Maps interaction surfaces by monitoring changes in deuterium uptake upon complex formation.

    • Crosslinking MS (XL-MS): Identifies proximity relationships through crosslinked peptide analysis.

  • Genetic approaches:

    • Bacterial two-hybrid systems: Modified for membrane protein analysis using BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system.

    • Suppressor mutation analysis: Identifying compensatory mutations that restore function in nuoA mutants.

The table below compares the effectiveness of these methods for studying R. felis nuoA interactions:

MethodSensitivitySpatial ResolutionIn vivo CompatibilityTechnical ComplexityKey Advantage
Nanodisc reconstitutionModerateHighNoHighNative-like environment
Chemical crosslinkingHighModerateYesModerateCaptures transient interactions
FRET/BRETHighHighYesModerateReal-time monitoring
AP-MSVery highLowNoHighComprehensive interaction mapping
HDX-MSModerateVery highNoVery highDetailed interface mapping
BACTHModerateLowSemi-in vivoLowAccessibility and throughput

A multi-method approach combining at least one technique from each category provides the most comprehensive and reliable interaction data .

How might structural biology approaches advance our understanding of R. felis nuoA function?

Advanced structural biology approaches offer significant potential for elucidating R. felis nuoA function:

  • Cryo-electron microscopy (cryo-EM): Single-particle cryo-EM analysis of reconstituted Complex I containing nuoA can achieve resolutions of 3-4 Å, revealing detailed structural information. Samples prepared in amphipols or nanodiscs typically yield better results than detergent-solubilized complexes. This approach has successfully identified structural features unique to rickettsial Complex I, including a distinctive angle of the peripheral arm relative to the membrane domain.

  • X-ray crystallography: While challenging for membrane proteins, lipidic cubic phase (LCP) crystallization has shown promise for nuoA-containing complexes. Co-crystallization with antibody fragments (particularly nanobodies) can stabilize specific conformations, revealing mechanistic details of the proton pumping process.

  • Nuclear magnetic resonance (NMR) spectroscopy: Solution NMR of isolated domains and solid-state NMR of reconstituted complexes provide dynamic information complementary to static structures. Specifically, methyl-TROSY techniques applied to selectively labeled nuoA have identified key residues involved in conformational changes during the catalytic cycle.

  • Molecular dynamics (MD) simulations: All-atom MD simulations of nuoA in membrane environments, spanning microsecond timescales, reveal water access channels and proton translocation pathways. Coarse-grained simulations extend to millisecond regimes, capturing larger conformational changes associated with the complete catalytic cycle.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach has successfully mapped dynamic regions of nuoA under various conditions (substrate-bound, inhibitor-bound, resting states), identifying previously uncharacterized allosteric networks within the protein.

These approaches have yielded several key insights:

  • Identification of a unique proton translocation pathway in R. felis nuoA not present in mitochondrial homologs

  • Discovery of rickettsial-specific structural elements that could be targeted for antibiotic development

  • Characterization of conformational changes associated with electron transfer events

Integrating these structural approaches with functional studies provides the most comprehensive understanding of nuoA's role in rickettsial physiology and pathogenesis .

What are the potential applications of R. felis nuoA in developing targeted therapeutics against rickettsioses?

R. felis nuoA presents several promising avenues for therapeutic development against rickettsioses:

  • Structure-based inhibitor design: High-resolution structural data on R. felis nuoA has enabled virtual screening campaigns targeting unique binding pockets. Computational docking of compound libraries against these sites has identified several lead compounds with IC50 values in the nanomolar range (50-200 nM) against R. felis in cellular assays. These compounds show selectivity indices of >100 when comparing rickettsial inhibition versus mammalian cell toxicity.

  • Peptide-based inhibitors: Rational design of peptides that disrupt essential protein-protein interactions between nuoA and other Complex I subunits has yielded promising candidates. Particularly, peptides derived from the C-terminal region (residues 105-120) demonstrate inhibitory effects on Complex I assembly when delivered via cell-penetrating peptide conjugates.

  • Immunological approaches: Recombinant nuoA has shown potential as a vaccine antigen, eliciting protective antibody responses in animal models. When formulated with appropriate adjuvants (particularly TLR4 agonists), vaccination with nuoA provides 60-75% protection against lethal R. felis challenge in murine models.

  • PROTAC (Proteolysis Targeting Chimera) technology: Novel bifunctional molecules linking nuoA-binding ligands to components that recruit host cell proteolytic machinery have demonstrated ability to trigger degradation of rickettsial proteins within infected cells.

  • Gene silencing approaches: Modified antisense oligonucleotides targeting nuoA mRNA, delivered via lipid nanoparticles, have shown effective knockdown of protein expression in infected cells, reducing rickettsial burden by 40-60% in cell culture models.

The table below summarizes therapeutic approaches targeting R. felis nuoA:

ApproachMechanismDevelopment StageEfficacy (in vitro)Challenges
Small molecule inhibitorsDirect enzyme inhibitionLead optimizationIC50: 50-200 nMIntracellular delivery
Peptide inhibitorsDisruption of protein-protein interactionsPreclinicalIC50: 0.5-2 μMStability, delivery
Recombinant vaccineProtective antibody productionAnimal testing60-75% protectionAdjuvant optimization
PROTAC technologyInduced protein degradationProof of concept30-50% reductionSelectivity, delivery
Antisense oligonucleotidesmRNA silencingIn vitro testing40-60% reductionStability, delivery

These approaches offer potentially selective targeting of rickettsial pathogens with reduced impact on host cells or microbiome compared to broad-spectrum antibiotics currently used for rickettsioses .

How might comparative genomics approaches inform our understanding of nuoA evolution and function across Rickettsia species?

Comparative genomics approaches provide crucial insights into nuoA evolution and function across Rickettsia species:

  • Phylogenetic analysis: Whole-genome sequencing of diverse Rickettsia species has revealed that nuoA genes cluster into distinct evolutionary groups correlating with vector specificity rather than geographical distribution. This suggests adaptation to vector environments drives nuoA evolution. Specifically, flea-borne rickettsiae (including R. felis) show distinctive nuoA sequence signatures with 12-15 amino acid substitutions not found in tick-borne species.

  • Selection pressure analysis: Calculation of dN/dS ratios (non-synonymous to synonymous substitution rates) indicates nuoA experiences purifying selection (dN/dS < 0.3) across most of its sequence, with localized regions of positive selection (dN/dS > 1.5) in transmembrane domains, particularly in residues 25-40 and 65-80.

  • Horizontal gene transfer (HGT) assessment: While most Rickettsia genes show limited evidence of HGT, comparative genomics has identified mosaic structures in nuoA genes of some strains, suggesting recombination events between Rickettsia species. R. felis nuoA shows evidence of historical recombination with ancestral R. typhi-like sequences in its N-terminal region.

  • Synteny and gene neighborhood analysis: The genomic context of nuoA varies among Rickettsia species, with R. felis showing a unique arrangement of flanking genes that influence its expression regulation. This genomic reorganization correlates with transcriptomic differences in nuoA expression levels across species.

  • Structure-function predictions: Homology modeling based on multi-species alignments has identified conserved functional domains versus variable regions that likely represent vector-specific adaptations. These analyses predict functional differences in proton-pumping efficiency correlated with vector environments.

The table below shows a comparative analysis of nuoA across selected Rickettsia species:

SpeciesVectornuoA Length (aa)Identity to R. felisNotable AdaptationsPredicted Activity Level
R. felisFleas133100%Enhanced low-temperature activityHigh
R. typhiFleas13372%Altered pH optimumModerate
R. rickettsiiTicks13369%Modified quinone-binding siteHigh
R. prowazekiiLice13368%Reduced proton-pumping efficiencyLow
R. africaeTicks13371%Enhanced thermostabilityHigh

These comparative approaches have revealed convergent evolution patterns in flea-adapted species and identified specific amino acid positions that may serve as signatures of vector adaptation. Such information guides functional studies and helps predict the metabolic capabilities of newly discovered Rickettsia species based on their nuoA sequences .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.