Recombinant Rickettsia felis Phosphatidate cytidylyltransferase (cdsA)

Shipped with Ice Packs
In Stock

Description

Introduction and Functional Overview

Recombinant Rickettsia felis Phosphatidate cytidylyltransferase (cdsA) is a critical enzyme encoded by the cdsA gene in the spotted fever group (SFG) bacterium Rickettsia felis. This enzyme catalyzes the transfer of cytidylyl groups to phosphatidate, a key step in phospholipid biosynthesis (EC 2.7.7.41). It is also designated as CDP-diacylglycerol (CDP-DAG) synthase or CDP-diglyceride pyrophosphorylase .

PropertyDetail
Enzyme NamePhosphatidate cytidylyltransferase
Alternative NamesCDP-DAG synthase, CDP-DG synthase, CDP-diacylglycerol synthase
EC Number2.7.7.41
Gene NamecdsA
Uniprot IDQ4µLR7 (hypothetical; actual ID requires confirmation)

Genomic Context

The cdsA gene is part of the R. felis genome, which includes a circular chromosome (1,485,148 bp) and conjugative plasmids (pRF and pRFδ) . The enzyme is encoded on the plasmid pRF in strain URRWXCal2, with a length of 227 amino acids (AA) .

StrainPlasmidcdsA PresenceKey Features
URRWXCal2pRFYes62-kb plasmid with 24 additional ORFs
LSU-LbpRFδNo39-kb plasmid (lacks cdsA in some cells)
Marseille-URRWXCal2pRFYesReference strain for genomic studies

Note: Plasmid pRFδ lacks cdsA in some isolates, suggesting variability in plasmid content .

Amino Acid Sequence

The recombinant cdsA protein (MITQKGKEHLAKDKQNIYLRILSGIVLVPLFVIAILWFKPLFYILMILVGMGmLSEWYNM TYSSIPYLLIGLIIIPIPISLLTFLSMEDTNRWLImLYFCIIWSVDSFAMIGGKTFKGAK LAPKISPKKTWSGLVTGVLSAGLVAVLASFIPNFHIENYYFSNKIYLFIISCILALIAQS SDLFISYLKRKFNIKDSGHIIPGHGGVLDRFDSIILTAPVLFFISIL) exhibits conserved motifs for nucleotide binding and catalysis .

Expression and Production

Recombinant cdsA is produced via heterologous expression systems, typically in E. coli, with purification methods including affinity chromatography. Key parameters include:

ParameterDetail
Purity>95% (via SDS-PAGE and Western blot)
FormulationTris-based buffer, 50% glycerol, pH 7.4
Storage-20°C (stable for >1 year)
ApplicationsELISA assays, biochemical studies, vaccine development

Diagnostic Utility

Recombinant cdsA is used in serological assays (e.g., ELISA) to detect R. felis infections, leveraging its immunogenicity .

Biochemical Studies

  • Lipid Metabolism: cdsA catalyzes phosphatidate + CTP → CDP-diacylglycerol + PPi, a precursor for phosphatidylglycerol and cardiolipin .

  • Plasmid Dynamics: Strain-dependent plasmid content (pRF vs. pRFδ) influences cdsA expression, affecting bacterial fitness in fleas and vertebrate hosts .

StudyFinding
Genome sequencing (2005)cdsA identified as plasmid-encoded virulence factor
Plasmid variability (2008)pRFδ lacks cdsA in 25% of R. felis cells
Host-pathogen interactioncdsA linked to evasion of flea immune responses (indirect evidence)

Table 1: cdsA Sequence Breakdown

RegionSequence
N-TerminalMITQKGKEHLAKDKQNIYLRILSGIVLVPLFVIAILWFKPLFYILMILVGMGmLSEWYNM
C-TerminalSDLFISYLKRKFNIKDSGHIIPGHGGVLDRFDSIILTAPVLFFISIL

Table 2: cdsA-Related Plasmid Variations

StrainPlasmidcdsA StatusSource
URRWXCal2pRFPresentGenBank CP000053
LSU-LbpRFδAbsentLSU colony
Marseille-URRWXCal2pRFPresentCSUR R121

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
cdsA; RF_0655; Phosphatidate cytidylyltransferase; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)
Target Names
cdsA
Target Protein Sequence
MITQKGKEHLAKDKQNIYLRILSGIVLVPLFVIAILWFKPLFYILMILVGMGMLSEWYNM TYSSIPYLLIGLIIIPIPISLLTFLSMEDTNRWLIMLYFCIIWSVDSFAMIGGKTFKGAK LAPKISPKKTWSGLVTGVLSAGLVAVLASFIPNFHIENYYFSNKIYLFIISCILALIAQS SDLFISYLKRKFNIKDSGHIIPGHGGVLDRFDSIILTAPVLFFISIL
Uniprot No.

Target Background

Database Links

KEGG: rfe:RF_0655

STRING: 315456.RF_0655

Protein Families
CDS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Phosphatidate cytidylyltransferase (cdsA) and what role does it play in Rickettsia felis metabolism?

Phosphatidate cytidylyltransferase (cdsA) in R. felis is an essential enzyme (EC 2.7.7.41) that catalyzes the conversion of phosphatidic acid to CDP-diacylglycerol, a critical intermediate in phospholipid biosynthesis. This enzyme is also known as CDP-DAG synthase, CDP-DG synthase, CDP-diglyceride pyrophosphorylase, or CDP-diglyceride synthase . As an obligate intracellular bacterium, R. felis relies on this enzyme for membrane phospholipid synthesis, which is crucial for cellular integrity and replication within host cells. The protein consists of 227 amino acids and contains multiple transmembrane domains characteristic of membrane-associated enzymes .

Methodologically, researchers investigating cdsA function should consider:

  • Measuring enzyme activity using radiolabeled substrates to track phospholipid synthesis rates

  • Employing lipidomic analyses to assess changes in membrane composition when cdsA expression is altered

  • Using fluorescently tagged cdsA to visualize its localization within bacterial cells during different growth phases

How is the cdsA gene structured in the R. felis genome compared to other rickettsial species?

The cdsA gene (labeled as RF_0655 in the genome) in R. felis is part of the core genome shared among rickettsial species, but exhibits unique features compared to other rickettsia. Genome sequencing has revealed that R. felis possesses distinct genetic characteristics including numerous transposases, chromosomal toxin-antitoxin genes, multiple spoT genes, and an unusually high number of ankyrin- and tetratricopeptide-motif-containing genes .

Unlike many other rickettsial species, R. felis harbors both chromosomal genes and plasmid-borne elements. The genome consists of a circular chromosome of 1,485,148 bp and contains the first identified putative conjugative plasmid among obligate intracellular bacteria, which exists in both short (39,263 bp) and long (62,829 bp) forms . These genomic features potentially influence the expression and regulation of metabolic genes like cdsA.

What are the optimal expression systems for producing functional recombinant R. felis cdsA?

For successful expression of functional R. felis cdsA, researchers should consider the following methodological approaches:

Prokaryotic Expression Systems:

  • E. coli BL21(DE3) with codon optimization for membrane proteins

  • Use of fusion tags (His, MBP, or GST) to improve solubility and facilitate purification

  • Expression at lower temperatures (16-20°C) to enhance proper protein folding

  • Inclusion of phospholipids in the expression media to stabilize the membrane protein

Eukaryotic Expression Systems:

  • Insect cell lines (Sf9, Sf21) with baculovirus vectors for closer approximation to arthropod conditions

  • Tick cell lines such as ISE6 (from Ixodes scapularis) which have been successfully used for R. felis culture

The choice between these systems should be guided by the intended application, as each system offers different advantages in terms of protein folding, post-translational modifications, and functional activity.

What challenges are associated with studying cdsA enzymatic activity and how can they be overcome?

Studying cdsA enzymatic activity presents several methodological challenges:

Challenge 1: Membrane Protein Solubility

  • Solution: Use mild detergents (DDM, CHAPS) during extraction

  • Develop nanodiscs or liposome reconstitution systems to maintain native-like membrane environment

Challenge 2: Maintaining Enzymatic Activity During Purification

  • Solution: Employ rapid purification protocols at 4°C

  • Include stabilizing agents (glycerol, specific lipids) in all buffers

  • Consider on-column refolding techniques for proteins expressed as inclusion bodies

Challenge 3: Assay Development

  • Solution: Utilize coupled enzyme assays to monitor CMP production

  • Develop LC-MS/MS methods to directly quantify CDP-diacylglycerol formation

  • Employ fluorescently labeled substrates for real-time activity monitoring

How does the expression of cdsA in R. felis vary between different host cell types?

The expression of cdsA in R. felis shows notable variation when cultured in different host cell types, which has significant implications for understanding host-pathogen interactions:

Host Cell TypecdsA Expression PatternObservable Cytopathic EffectsReference
ISE6 tick cellsConstitutive expressionIncreased vacuolization; no cell lysis
Mammalian Vero cellsTemperature-dependent expressionReduced growth above 32°C
XTC-2 amphibian cellsStable expression at lower temperaturesOptimal growth below 32°C
C6/36 insect cellsSimilar to amphibian cellsRequires centrifugation for isolation

R. felis cultured in the ISE6 tick cell line demonstrates a cytopathic effect characterized by increased vacuolization, though cell lysis is not evident despite large numbers of rickettsiae . This contrasts with the behavior in Vero cells, suggesting that host-specific factors influence cdsA expression and function. Methodologically, researchers should monitor cdsA expression using qRT-PCR across different culture conditions and correlate this with phospholipid synthesis rates to understand the metabolic adaptation of R. felis to different host environments.

What is the relationship between cdsA function and R. felis transmission in arthropod vectors?

The relationship between cdsA function and R. felis transmission is complex and involves multiple factors:

  • Vertical Transmission Dynamics: R. felis is maintained in cat fleas through vertical transmission , suggesting that phospholipid metabolism, including cdsA activity, must be properly regulated during transovarial passage.

  • Interaction with Endosymbionts: The presence of other endosymbionts, particularly Wolbachia, impacts R. felis transmission in cat flea populations . This interaction may involve competition for metabolic resources or direct interference with phospholipid synthesis pathways.

  • Temperature-Dependent Regulation: R. felis exhibits optimal growth at temperatures below 32°C , indicating that cdsA and related metabolic enzymes may be adapted to function optimally in arthropod hosts rather than mammalian hosts.

Methodologically, researchers investigating this relationship should:

  • Develop gene silencing approaches (RNAi) targeting cdsA to assess its impact on vertical transmission rates

  • Compare cdsA expression levels between infected fleas that successfully transmit R. felis to offspring and those that do not

  • Analyze how temperature fluctuations affect cdsA activity and correlate this with transmission efficiency

How can CRISPR-based approaches be adapted for studying cdsA function in R. felis?

CRISPR-based approaches for studying obligate intracellular bacteria like R. felis present unique challenges but offer powerful insights into gene function. For cdsA research, consider the following methodological adaptations:

Delivery Systems:

  • Electroporation of CRISPR components during host cell infection

  • Packaging CRISPR machinery in cell-penetrating peptides

  • Host-cell expression systems with subsequent transfer to rickettsiae

Target Design Considerations:

  • Use computational analysis to identify PAM sites in cdsA that are unique to R. felis

  • Design guide RNAs targeting conserved catalytic domains

  • Include controls targeting non-essential genes to validate the system

Phenotypic Assessment:

  • Monitor growth rate and morphological changes in modified R. felis

  • Quantify phospholipid composition alterations using mass spectrometry

  • Assess transmission efficiency in arthropod models

Given that R. felis contains conjugative plasmids , researchers might leverage these natural genetic transfer mechanisms to introduce CRISPR components. The observation of conjugative pili and mating in R. felis suggests that horizontal gene transfer systems could potentially be harnessed for genetic manipulation.

What structural insights can computational modeling provide about R. felis cdsA as a potential antimicrobial target?

Computational modeling of R. felis cdsA can provide valuable structural insights relevant to antimicrobial development:

Homology Modeling Approaches:

  • Utilize crystal structures of cdsA homologs from other bacteria as templates

  • Incorporate R. felis-specific sequence features, particularly the transmembrane domains

  • Validate models using molecular dynamics simulations in membrane environments

Binding Site Analysis:

  • Identify unique pockets in the R. felis cdsA structure compared to host enzymes

  • Characterize the catalytic site architecture using quantum mechanical calculations

  • Map evolutionary conservation patterns to identify essential structural elements

Virtual Screening Workflow:

  • Develop a pharmacophore model based on substrate binding requirements

  • Screen compound libraries against identified binding sites

  • Prioritize compounds that exploit structural features unique to bacterial cdsA

The amino acid sequence of R. felis cdsA (MITQKGKEHLA...PVLFFISIL) contains regions that could be targeted by small molecules without affecting host enzymes. Analysis should focus on the functional domains associated with CTP binding and catalysis, as these represent potential intervention points.

How does the interaction between Wolbachia and R. felis affect cdsA expression and phospholipid metabolism?

Recent research suggests complex interactions between R. felis and Wolbachia endosymbionts in arthropod hosts, with potential implications for cdsA function and phospholipid metabolism:

  • Competition for Metabolic Resources: Both Wolbachia and R. felis are obligate intracellular bacteria that rely on host phospholipids and may compete for precursors needed by cdsA.

  • Transmission Interference: Studies have provided evidence that Wolbachia can impact R. felis transmission in cat flea populations , suggesting metabolic or regulatory interactions.

  • Regulatory Cross-talk: Potential exists for signaling molecules from one bacterium to influence gene expression in the other, potentially affecting cdsA transcription.

Methodologically, researchers investigating these interactions should:

  • Perform comparative transcriptomics on R. felis from Wolbachia-positive and Wolbachia-negative flea populations

  • Develop in vitro systems with controlled introduction of both bacteria to assess metabolic competition

  • Use metabolic labeling to track phospholipid synthesis and allocation between the bacteria

The variability in R. felis vertical transmission may be partially explained by these interactions, suggesting that phospholipid metabolism is a key factor in transmission success.

What roles might R. felis cdsA play in adaptation to different arthropod vectors?

R. felis has been identified in over 40 arthropod species including fleas, ticks, and mosquitoes , suggesting remarkable adaptability across vector species. The cdsA enzyme may play crucial roles in this adaptation:

Temperature Adaptation:

  • R. felis exhibits optimal growth at temperatures below 32°C , suggesting cdsA functions optimally within the temperature range of arthropod hosts

  • Researchers should assess cdsA enzymatic activity across temperature gradients relevant to different vector species

Membrane Composition Adjustment:

  • Different arthropod species provide varying lipid environments

  • cdsA activity may be modulated to produce appropriate phospholipids for each host environment

  • Methodologically, comparative lipidomics between R. felis grown in different vector-derived cell lines would provide insights

Vector-Specific Regulation:

  • The successful cultivation of R. felis in tick-derived ISE6 cells suggests conservation of essential host-pathogen interactions across arthropod species

  • Regulatory elements controlling cdsA expression may respond to vector-specific signals

Understanding these adaptations requires integrating genomic, transcriptomic, and biochemical approaches to characterize cdsA function across different vector contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.