Recombinant Rickettsia felis Phosphatidate cytidylyltransferase (cdsA) is a critical enzyme encoded by the cdsA gene in the spotted fever group (SFG) bacterium Rickettsia felis. This enzyme catalyzes the transfer of cytidylyl groups to phosphatidate, a key step in phospholipid biosynthesis (EC 2.7.7.41). It is also designated as CDP-diacylglycerol (CDP-DAG) synthase or CDP-diglyceride pyrophosphorylase .
| Property | Detail |
|---|---|
| Enzyme Name | Phosphatidate cytidylyltransferase |
| Alternative Names | CDP-DAG synthase, CDP-DG synthase, CDP-diacylglycerol synthase |
| EC Number | 2.7.7.41 |
| Gene Name | cdsA |
| Uniprot ID | Q4µLR7 (hypothetical; actual ID requires confirmation) |
The cdsA gene is part of the R. felis genome, which includes a circular chromosome (1,485,148 bp) and conjugative plasmids (pRF and pRFδ) . The enzyme is encoded on the plasmid pRF in strain URRWXCal2, with a length of 227 amino acids (AA) .
| Strain | Plasmid | cdsA Presence | Key Features |
|---|---|---|---|
| URRWXCal2 | pRF | Yes | 62-kb plasmid with 24 additional ORFs |
| LSU-Lb | pRFδ | No | 39-kb plasmid (lacks cdsA in some cells) |
| Marseille-URRWXCal2 | pRF | Yes | Reference strain for genomic studies |
Note: Plasmid pRFδ lacks cdsA in some isolates, suggesting variability in plasmid content .
The recombinant cdsA protein (MITQKGKEHLAKDKQNIYLRILSGIVLVPLFVIAILWFKPLFYILMILVGMGmLSEWYNM TYSSIPYLLIGLIIIPIPISLLTFLSMEDTNRWLImLYFCIIWSVDSFAMIGGKTFKGAK LAPKISPKKTWSGLVTGVLSAGLVAVLASFIPNFHIENYYFSNKIYLFIISCILALIAQS SDLFISYLKRKFNIKDSGHIIPGHGGVLDRFDSIILTAPVLFFISIL) exhibits conserved motifs for nucleotide binding and catalysis .
Recombinant cdsA is produced via heterologous expression systems, typically in E. coli, with purification methods including affinity chromatography. Key parameters include:
| Parameter | Detail |
|---|---|
| Purity | >95% (via SDS-PAGE and Western blot) |
| Formulation | Tris-based buffer, 50% glycerol, pH 7.4 |
| Storage | -20°C (stable for >1 year) |
| Applications | ELISA assays, biochemical studies, vaccine development |
Recombinant cdsA is used in serological assays (e.g., ELISA) to detect R. felis infections, leveraging its immunogenicity .
Lipid Metabolism: cdsA catalyzes phosphatidate + CTP → CDP-diacylglycerol + PPi, a precursor for phosphatidylglycerol and cardiolipin .
Plasmid Dynamics: Strain-dependent plasmid content (pRF vs. pRFδ) influences cdsA expression, affecting bacterial fitness in fleas and vertebrate hosts .
| Region | Sequence |
|---|---|
| N-Terminal | MITQKGKEHLAKDKQNIYLRILSGIVLVPLFVIAILWFKPLFYILMILVGMGmLSEWYNM |
| C-Terminal | SDLFISYLKRKFNIKDSGHIIPGHGGVLDRFDSIILTAPVLFFISIL |
KEGG: rfe:RF_0655
STRING: 315456.RF_0655
Phosphatidate cytidylyltransferase (cdsA) in R. felis is an essential enzyme (EC 2.7.7.41) that catalyzes the conversion of phosphatidic acid to CDP-diacylglycerol, a critical intermediate in phospholipid biosynthesis. This enzyme is also known as CDP-DAG synthase, CDP-DG synthase, CDP-diglyceride pyrophosphorylase, or CDP-diglyceride synthase . As an obligate intracellular bacterium, R. felis relies on this enzyme for membrane phospholipid synthesis, which is crucial for cellular integrity and replication within host cells. The protein consists of 227 amino acids and contains multiple transmembrane domains characteristic of membrane-associated enzymes .
Methodologically, researchers investigating cdsA function should consider:
Measuring enzyme activity using radiolabeled substrates to track phospholipid synthesis rates
Employing lipidomic analyses to assess changes in membrane composition when cdsA expression is altered
Using fluorescently tagged cdsA to visualize its localization within bacterial cells during different growth phases
The cdsA gene (labeled as RF_0655 in the genome) in R. felis is part of the core genome shared among rickettsial species, but exhibits unique features compared to other rickettsia. Genome sequencing has revealed that R. felis possesses distinct genetic characteristics including numerous transposases, chromosomal toxin-antitoxin genes, multiple spoT genes, and an unusually high number of ankyrin- and tetratricopeptide-motif-containing genes .
Unlike many other rickettsial species, R. felis harbors both chromosomal genes and plasmid-borne elements. The genome consists of a circular chromosome of 1,485,148 bp and contains the first identified putative conjugative plasmid among obligate intracellular bacteria, which exists in both short (39,263 bp) and long (62,829 bp) forms . These genomic features potentially influence the expression and regulation of metabolic genes like cdsA.
For successful expression of functional R. felis cdsA, researchers should consider the following methodological approaches:
Prokaryotic Expression Systems:
E. coli BL21(DE3) with codon optimization for membrane proteins
Use of fusion tags (His, MBP, or GST) to improve solubility and facilitate purification
Expression at lower temperatures (16-20°C) to enhance proper protein folding
Inclusion of phospholipids in the expression media to stabilize the membrane protein
Eukaryotic Expression Systems:
Insect cell lines (Sf9, Sf21) with baculovirus vectors for closer approximation to arthropod conditions
Tick cell lines such as ISE6 (from Ixodes scapularis) which have been successfully used for R. felis culture
The choice between these systems should be guided by the intended application, as each system offers different advantages in terms of protein folding, post-translational modifications, and functional activity.
Studying cdsA enzymatic activity presents several methodological challenges:
Solution: Use mild detergents (DDM, CHAPS) during extraction
Develop nanodiscs or liposome reconstitution systems to maintain native-like membrane environment
Solution: Employ rapid purification protocols at 4°C
Include stabilizing agents (glycerol, specific lipids) in all buffers
Consider on-column refolding techniques for proteins expressed as inclusion bodies
Solution: Utilize coupled enzyme assays to monitor CMP production
Develop LC-MS/MS methods to directly quantify CDP-diacylglycerol formation
Employ fluorescently labeled substrates for real-time activity monitoring
The expression of cdsA in R. felis shows notable variation when cultured in different host cell types, which has significant implications for understanding host-pathogen interactions:
R. felis cultured in the ISE6 tick cell line demonstrates a cytopathic effect characterized by increased vacuolization, though cell lysis is not evident despite large numbers of rickettsiae . This contrasts with the behavior in Vero cells, suggesting that host-specific factors influence cdsA expression and function. Methodologically, researchers should monitor cdsA expression using qRT-PCR across different culture conditions and correlate this with phospholipid synthesis rates to understand the metabolic adaptation of R. felis to different host environments.
The relationship between cdsA function and R. felis transmission is complex and involves multiple factors:
Vertical Transmission Dynamics: R. felis is maintained in cat fleas through vertical transmission , suggesting that phospholipid metabolism, including cdsA activity, must be properly regulated during transovarial passage.
Interaction with Endosymbionts: The presence of other endosymbionts, particularly Wolbachia, impacts R. felis transmission in cat flea populations . This interaction may involve competition for metabolic resources or direct interference with phospholipid synthesis pathways.
Temperature-Dependent Regulation: R. felis exhibits optimal growth at temperatures below 32°C , indicating that cdsA and related metabolic enzymes may be adapted to function optimally in arthropod hosts rather than mammalian hosts.
Methodologically, researchers investigating this relationship should:
Develop gene silencing approaches (RNAi) targeting cdsA to assess its impact on vertical transmission rates
Compare cdsA expression levels between infected fleas that successfully transmit R. felis to offspring and those that do not
Analyze how temperature fluctuations affect cdsA activity and correlate this with transmission efficiency
CRISPR-based approaches for studying obligate intracellular bacteria like R. felis present unique challenges but offer powerful insights into gene function. For cdsA research, consider the following methodological adaptations:
Delivery Systems:
Electroporation of CRISPR components during host cell infection
Packaging CRISPR machinery in cell-penetrating peptides
Host-cell expression systems with subsequent transfer to rickettsiae
Target Design Considerations:
Use computational analysis to identify PAM sites in cdsA that are unique to R. felis
Design guide RNAs targeting conserved catalytic domains
Include controls targeting non-essential genes to validate the system
Phenotypic Assessment:
Monitor growth rate and morphological changes in modified R. felis
Quantify phospholipid composition alterations using mass spectrometry
Assess transmission efficiency in arthropod models
Given that R. felis contains conjugative plasmids , researchers might leverage these natural genetic transfer mechanisms to introduce CRISPR components. The observation of conjugative pili and mating in R. felis suggests that horizontal gene transfer systems could potentially be harnessed for genetic manipulation.
Computational modeling of R. felis cdsA can provide valuable structural insights relevant to antimicrobial development:
Homology Modeling Approaches:
Utilize crystal structures of cdsA homologs from other bacteria as templates
Incorporate R. felis-specific sequence features, particularly the transmembrane domains
Validate models using molecular dynamics simulations in membrane environments
Binding Site Analysis:
Identify unique pockets in the R. felis cdsA structure compared to host enzymes
Characterize the catalytic site architecture using quantum mechanical calculations
Map evolutionary conservation patterns to identify essential structural elements
Virtual Screening Workflow:
Develop a pharmacophore model based on substrate binding requirements
Screen compound libraries against identified binding sites
Prioritize compounds that exploit structural features unique to bacterial cdsA
The amino acid sequence of R. felis cdsA (MITQKGKEHLA...PVLFFISIL) contains regions that could be targeted by small molecules without affecting host enzymes. Analysis should focus on the functional domains associated with CTP binding and catalysis, as these represent potential intervention points.
Recent research suggests complex interactions between R. felis and Wolbachia endosymbionts in arthropod hosts, with potential implications for cdsA function and phospholipid metabolism:
Competition for Metabolic Resources: Both Wolbachia and R. felis are obligate intracellular bacteria that rely on host phospholipids and may compete for precursors needed by cdsA.
Transmission Interference: Studies have provided evidence that Wolbachia can impact R. felis transmission in cat flea populations , suggesting metabolic or regulatory interactions.
Regulatory Cross-talk: Potential exists for signaling molecules from one bacterium to influence gene expression in the other, potentially affecting cdsA transcription.
Methodologically, researchers investigating these interactions should:
Perform comparative transcriptomics on R. felis from Wolbachia-positive and Wolbachia-negative flea populations
Develop in vitro systems with controlled introduction of both bacteria to assess metabolic competition
Use metabolic labeling to track phospholipid synthesis and allocation between the bacteria
The variability in R. felis vertical transmission may be partially explained by these interactions, suggesting that phospholipid metabolism is a key factor in transmission success.
R. felis has been identified in over 40 arthropod species including fleas, ticks, and mosquitoes , suggesting remarkable adaptability across vector species. The cdsA enzyme may play crucial roles in this adaptation:
Temperature Adaptation:
R. felis exhibits optimal growth at temperatures below 32°C , suggesting cdsA functions optimally within the temperature range of arthropod hosts
Researchers should assess cdsA enzymatic activity across temperature gradients relevant to different vector species
Membrane Composition Adjustment:
Different arthropod species provide varying lipid environments
cdsA activity may be modulated to produce appropriate phospholipids for each host environment
Methodologically, comparative lipidomics between R. felis grown in different vector-derived cell lines would provide insights
Vector-Specific Regulation:
The successful cultivation of R. felis in tick-derived ISE6 cells suggests conservation of essential host-pathogen interactions across arthropod species
Regulatory elements controlling cdsA expression may respond to vector-specific signals
Understanding these adaptations requires integrating genomic, transcriptomic, and biochemical approaches to characterize cdsA function across different vector contexts.