Recombinant Rickettsia felis Probable ABC transporter permease protein RF_0080 (RF_0080)

Shipped with Ice Packs
In Stock

Description

Role in ABC Transporter Complexes

RF_0080 belongs to the MlaE permease family, which is associated with lipid transport systems. ABC transporters typically consist of two permease subunits (e.g., MlaE) and two nucleotide-binding domains (NBDs). While RF_0080’s exact substrate remains uncharacterized, its structural homology suggests involvement in exporting hydrophobic molecules, such as lipids or virulence factors .

Pathogenic Relevance

Rickettsia felis is an obligate intracellular pathogen with unique genomic features, including plasmids and toxin–antitoxin systems . ABC transporters like RF_0080 may play roles in:

  • Nutrient acquisition: Transporting essential substrates from host cells.

  • Pathogenesis: Evading host immune responses or exporting virulence factors.

Genomic Context

The R. felis genome encodes 1,512 protein-coding genes, including multiple ABC transporters . RF_0080 is part of a larger family of transporters that contribute to the bacterium’s adaptability in flea and human hosts.

Current Research Gaps

  • Vaccine development: Targeting conserved transporter components.

  • Antibiotic resistance: ABC transporters may mediate efflux of β-lactams, as observed in R. felis .

Comparative Analysis of ABC Transporters in Rickettsia

FeatureRF_0080Other Rickettsia ABC Transporters
FamilyMlaE permeaseSca (surface cell antigen), Patatin
Expression HostE. coliNative flea/host cells
Functional DataLimited (predicted)Patatin: Host-cell invasion

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
RF_0080; Probable ABC transporter permease protein RF_0080
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)
Target Names
RF_0080
Target Protein Sequence
MLLNIANSVGKRTIKFAQSVGSFSLFSFAAVSSIIRPPLYLSLIIRQLLFIGFHSLPVVA MTTFFSGAVLALQSYTGFSRFSAESSIATVVVLSLTRELGPVLAGLMVAGRVGASIAAEI ATMRVTEQVDALYTLSTDPIKYLVFPRVIAAIITMPCLVLIGDIIGVMGGYLVGVYKLDF NSTAYLTSTFHYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVN SSILILISNYLITELFFKV
Uniprot No.

Target Background

Function
This protein may be part of an ABC transporter complex.
Database Links

KEGG: rfe:RF_0080

STRING: 315456.RF_0080

Protein Families
MlaE permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Rickettsia felis RF_0080 protein and what is its role in bacterial pathophysiology?

RF_0080 is classified as a probable ABC (ATP-binding cassette) transporter permease protein in Rickettsia felis. ABC transporters are integral membrane proteins that facilitate the movement of substrates across cellular membranes using energy from ATP hydrolysis .

In pathogenic bacteria like R. felis, ABC transporters play crucial roles in nutrient acquisition, toxin secretion, and potentially antibiotic resistance. While the specific substrate for RF_0080 remains undetermined, comparative analysis with other bacterial ABC transporters suggests it may be involved in the transport of essential nutrients, particularly metals such as zinc, manganese, or iron, which are critical for bacterial survival in metal-limited environments like those encountered during host infection .

The full-length RF_0080 protein consists of 259 amino acids and contains multiple transmembrane domains characteristic of permease components in ABC transporter systems .

How is recombinant RF_0080 typically expressed and purified for research applications?

Recombinant expression of RF_0080 typically involves cloning the gene into expression vectors suitable for bacterial systems, most commonly E. coli. The expressed protein is generally tagged with a His-tag to facilitate purification . The standard expression and purification protocol involves:

  • Gene synthesis or PCR amplification of the RF_0080 gene

  • Cloning into an expression vector with a suitable promoter and tag (commonly N-terminal His-tag)

  • Transformation into an E. coli expression strain, typically BL21(DE3)pLysS

  • Induction of protein expression using IPTG or other inducers

  • Cell lysis to release the recombinant protein

  • Purification using Ni-NTA affinity chromatography, leveraging the His-tag

  • Further purification using size exclusion or ion exchange chromatography if needed

  • Storage in an appropriate buffer, often with glycerol as a cryoprotectant

Because RF_0080 is a membrane protein with multiple transmembrane domains, expression can be challenging. Specialized E. coli strains designed for membrane protein expression and detergent solubilization steps are often necessary to obtain functional protein .

What experimental methods are used to determine the substrate specificity of ABC transporters like RF_0080?

Determining substrate specificity for ABC transporters involves multiple complementary approaches:

  • Genetic approaches: Knockout/knockdown studies to observe phenotypic changes and complementation experiments to restore function.

  • Biochemical assays:

    • Substrate binding assays using purified protein and radiolabeled or fluorescently tagged potential substrates

    • ATPase activity measurements in the presence of various substrates

    • Transport assays using reconstituted proteoliposomes or inverted membrane vesicles

  • Structural studies:

    • X-ray crystallography or cryo-EM to determine protein structure, particularly the substrate-binding pocket

    • Molecular dynamics simulations to predict substrate interactions

  • Comparative genomics:

    • Sequence comparison with characterized ABC transporters from related organisms

    • Analysis of genomic context, as genes for transporters are often co-located with genes involved in metabolism of the transported substrate

For RF_0080 specifically, comparison with similar ABC transporters in cluster A-I suggests possible involvement in metal ion transport, particularly zinc .

How do conformational changes in ABC transporters like RF_0080 contribute to substrate translocation?

ABC transporters undergo significant conformational changes during the transport cycle, which are essential for substrate translocation. Studies on similar ABC transporters reveal:

  • ATP-driven transport mechanism: Binding of ATP to the nucleotide-binding domains (NBDs) drives dimerization of these domains, which induces conformational changes in the transmembrane domains (TMDs) where RF_0080 is located .

  • Alternating access model: The conformational changes follow an alternating access mechanism, where the substrate-binding site alternates between being accessible from either side of the membrane .

  • Magnitude of conformational changes: Research using pulse double electron-electron resonance and fluorescence homotransfer measurements has shown that ATP hydrolysis can induce large-scale movements of up to 33 Å between the two ABC domains . These movements are coupled to reorientation of the transmembrane domains, creating an alternating access pathway for substrate translocation.

  • Substrate sequestering: During transport, substrates are sequestered in the cytoplasmic chamber prior to translocation through 10-20 Å conformational changes in the protein structure .

Understanding these conformational dynamics is essential for elucidating the complete transport mechanism of RF_0080 and developing potential inhibitors.

What role might RF_0080 play in the unique pathogenicity and lifecycle of Rickettsia felis?

Rickettsia felis has unique characteristics among rickettsial species, including the presence of plasmids and its association with flea vectors. The RF_0080 ABC transporter may contribute to pathogenicity in several ways:

  • Nutrient acquisition during intracellular lifecycle: As an obligate intracellular pathogen, R. felis depends on host resources. RF_0080 might be involved in acquiring essential nutrients, particularly metal ions, from the host cell environment .

  • Survival in vector and mammalian hosts: R. felis must adapt to different environments in its arthropod vector (fleas) and mammalian hosts. ABC transporters like RF_0080 may facilitate adaptation to these diverse environments by enabling the acquisition of different nutrients .

  • Contribution to antibiotic resistance: Some ABC transporters can export antibiotics, contributing to resistance. While not definitively characterized, RF_0080 could potentially contribute to the innate resistance of R. felis to certain antibiotics .

  • Metal homeostasis during infection: Compared to other Rickettsia species, R. felis has unique genomic features including plasmids and transposable elements, suggesting a more plastic genome that may confer adaptability to different hosts . ABC transporters like RF_0080 might support this adaptability through maintaining proper metal ion concentrations in different host environments.

The presence of two distinct zinc ABC transporter systems in some bacteria suggests functional redundancy that may be important for survival in zinc-limited environments, including those encountered during host infection .

How can structural studies of RF_0080 inform the development of novel antimicrobial strategies?

Structural studies of RF_0080 offer several avenues for antimicrobial development:

  • Structure-based drug design: Determination of the three-dimensional structure of RF_0080 through X-ray crystallography, cryo-EM, or computational modeling can reveal binding pockets suitable for targeted inhibitor design .

  • Comparative structural analysis: Comparing RF_0080 structure with human ABC transporters could highlight structural differences that allow for selective targeting of the bacterial protein .

  • Identification of critical residues: Site-directed mutagenesis informed by structural data can identify residues essential for transport function, providing specific targets for inhibitor development .

  • Novel antimicrobial targets: The RF_0080 protein represents a potential novel target for antimicrobial development, particularly significant since ABC transporters like RF_0080 are present in several human pathogens .

A structure-function approach combining structural studies with functional assays would be most effective for developing inhibitors that could interfere with essential transport processes mediated by RF_0080.

What experimental challenges exist in studying the interaction between substrate-binding proteins and permease components like RF_0080 in ABC transport systems?

Studying interactions between substrate-binding proteins (SBPs) and permease components like RF_0080 presents several experimental challenges:

  • Membrane protein isolation: Maintaining functional integrity of membrane proteins during purification is challenging due to their hydrophobic nature and requirement for proper lipid environment .

  • Reconstitution systems: Recreating a native-like membrane environment for functional studies often requires complex liposome reconstitution systems or nanodiscs .

  • Transient interactions: The interaction between SBPs and permease components may be transient and dependent on substrate binding and ATP hydrolysis, making it difficult to capture using traditional binding assays .

  • Conformational dynamics: ABC transporters undergo significant conformational changes during transport cycles, complicating structural studies that typically capture static states .

  • Specificity determination: The specificity of SBP-permease interactions is highly specific and does not always require the flexible loop features of the SBP, as demonstrated in studies of zinc ABC transporter systems .

The table below summarizes research findings on the specificity of interactions between components of zinc ABC transporters:

System ComponentFindingResearch Implication
SBP-permease interactionHighly specific without requiring flexible loop featuresSuggests a conserved binding interface independent of variable loop regions
Multiple SBPs per transporterSome ABC transporters can have 1-4 substrate-binding domains fused to translocator proteinMay enhance transport capacity or provide cooperative interactions
Effect on transport kineticsPossible cooperative behavior with multiple SBPsTransport rate may increase sigmoidally with SBP concentration
Chimeric SBP arrangementsFound in limited families of ABC superfamilyAssociated with systems transporting substrates to extraordinarily high levels

How can genomic and bioinformatic approaches be used to understand the evolution and function of RF_0080 in the context of Rickettsia felis's unique genome?

R. felis has a unique genome among Rickettsia species, featuring plasmids and a high number of transposable elements. Genomic and bioinformatic approaches to study RF_0080 include:

  • Comparative genomics: Analysis of RF_0080 homologs across Rickettsia species reveals evolutionary patterns and functional conservation. R. felis contrasts with previously sequenced Rickettsia in many features, including a large number of transposases, chromosomal toxin-antitoxin genes, spoT genes, and ankyrin-containing genes .

  • Phylogenetic analysis: Constructing phylogenetic trees of ABC transporters can reveal the evolutionary history of RF_0080 and its relationship to transporters with known functions .

  • Genome context analysis: Examining genes located near RF_0080 may provide clues about its function, as functionally related genes are often clustered together .

  • Transcriptomic analysis: RNA-Seq data can reveal expression patterns of RF_0080 under different conditions, suggesting when the protein is functionally important .

  • Detection of horizontal gene transfer: The presence of plasmids and transposable elements in R. felis suggests potential horizontal gene transfer events that may have influenced RF_0080 evolution .

Research has shown that R. felis has undergone significant genomic rearrangements through recombination mediated by mobile sequences, with at least 11 inversion events identified between R. felis and R. conorii . Understanding these genomic dynamics provides context for the evolution and function of genes like RF_0080.

What are the most effective methods for detecting and diagnosing Rickettsia felis infections in clinical and research settings?

The diagnosis of R. felis infections presents challenges due to similarities with other rickettsial and non-rickettsial febrile illnesses. Current methods include:

  • Molecular detection:

    • PCR targeting specific genes such as gltA (citrate synthase) or htrA

    • Real-time PCR for increased sensitivity

    • DNA sequencing for definitive identification

  • Serological methods:

    • Immunofluorescence assay (IFA)

    • Enzyme-linked immunosorbent assay (ELISA)

    • Western blot using recombinant proteins

  • Novel recombinant protein-based approaches:

    • Use of recombinant outer membrane protein A (OmpA) peptides has shown promise for specific R. felis detection

    • Such methods overcome cross-reactivity issues with other rickettsial species

The table below summarizes the comparative effectiveness of different diagnostic methods:

MethodSensitivitySpecificity for R. felisLimitations
PCR with gltA geneHighModerate (requires sequencing)Requires acute phase sample
PCR with htrA geneHighHighRequires acute phase sample
IFA using R. felis antigenModerateLow (cross-reactivity)Cross-reactions with other rickettsiae
Recombinant OmpA ELISAHighHighLimited commercial availability

Research has shown that sera from patients infected with R. felis react with recombinant OmpA peptides, while sera from patients with other rickettsial infections do not, demonstrating the potential for development of specific diagnostic tests .

How can protein-protein interaction studies be designed to investigate the functional relationships between RF_0080 and other components of the ABC transporter complex?

Investigating protein-protein interactions (PPIs) within the ABC transporter complex involving RF_0080 requires specialized approaches due to the membrane-associated nature of these proteins:

  • Co-immunoprecipitation (Co-IP) with membrane protein adaptations:

    • Crosslinking prior to cell lysis to stabilize transient interactions

    • Detergent optimization to maintain protein structure while allowing solubilization

    • Pull-down assays using tagged RF_0080 or interacting partners

  • Förster Resonance Energy Transfer (FRET) approaches:

    • Labeling RF_0080 and potential interaction partners with appropriate fluorophores

    • Monitoring energy transfer as indication of protein proximity

    • Live cell FRET to observe interactions in near-native conditions

  • Surface Plasmon Resonance (SPR):

    • Immobilization of one component on sensor chip

    • Real-time monitoring of binding kinetics

    • Determination of binding constants for interaction partners

  • Bacterial Two-Hybrid (BTH) systems:

    • Adaptation of yeast two-hybrid for membrane proteins

    • Split adenylate cyclase or β-galactosidase reporters

    • Screening for interactions in bacterial host

  • Structural approaches:

    • Cross-linking coupled with mass spectrometry (XL-MS)

    • Cryo-electron microscopy of the entire complex

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

Research on ABC transporters has demonstrated that the interaction between solute-binding proteins and permease components (like RF_0080) is highly specific and critical for transporter function . Understanding these interactions could provide insights into the transport mechanism and potential inhibition strategies.

What genomic and proteomic approaches could advance our understanding of RF_0080 function in the context of R. felis pathogenesis?

Future research on RF_0080 would benefit from integrated genomic and proteomic approaches:

  • Comparative genomics across Rickettsia species:

    • Analysis of RF_0080 conservation, variation, and selection pressure

    • Identification of potential functional partners through gene neighborhood analysis

    • Correlation of RF_0080 variants with virulence phenotypes

  • Transcriptomic profiling:

    • RNA-Seq analysis of R. felis under different conditions (host cell types, stress conditions)

    • Identification of co-regulated genes suggesting functional relationships

    • Temporal expression patterns during different stages of infection

  • Proteomic approaches:

    • Interactome mapping using proximity labeling techniques (BioID, APEX)

    • Post-translational modification analysis to identify regulatory mechanisms

    • Quantitative proteomics to measure abundance changes during infection

  • CRISPR-based approaches:

    • Development of CRISPR interference systems for obligate intracellular bacteria

    • Targeted repression of RF_0080 to assess phenotypic effects

    • CRISPRi screens to identify synthetic lethal interactions

  • Single-cell approaches:

    • Single-cell RNA-Seq of infected host cells to capture heterogeneity in bacterial responses

    • Spatial transcriptomics to map bacterial gene expression in different microenvironments

These approaches could help address key questions about the role of RF_0080 in R. felis pathogenesis, particularly its contribution to bacterial survival in different host environments and potential as a therapeutic target.

How might the study of RF_0080 contribute to our broader understanding of bacterial ABC transporters and their roles in pathogenesis?

The study of RF_0080 offers several opportunities to advance our understanding of bacterial ABC transporters:

  • Evolutionary insights:

    • R. felis represents a transitional group phylogenetically positioned between spotted fever group and typhus group rickettsiae

    • Comparative analysis of RF_0080 with homologs in other bacterial pathogens could reveal evolutionary adaptations to intracellular lifestyle

  • Structural and functional diversity:

    • ABC transporters exhibit diverse configurations, with one to four substrate-binding domains

    • Understanding RF_0080's structure could illuminate how structural variations impact function

  • Host-pathogen interactions:

    • ABC transporters like RF_0080 may be critical for acquiring nutrients in the intracellular environment

    • Investigation of RF_0080 substrates could reveal host resources targeted by intracellular pathogens

  • Novel antimicrobial strategies:

    • ABC transporters represent potential targets for new antibiotics

    • Insights from RF_0080 could guide development of inhibitors effective against multiple pathogens

  • Mechanisms of transport:

    • Studies of conformational changes in ABC transporters reveal movements of 33 Å between domains

    • Detailed mechanistic studies of RF_0080 could contribute to understanding transport energetics

The growing recognition of R. felis as an emergent global threat for humans underscores the importance of understanding virulence factors like RF_0080 that may contribute to pathogenesis and could serve as targets for intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.