Recombinant Rickettsia felis Probable cytochrome c oxidase subunit 2 (ctaC)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is produced in E. coli with an N-terminal His tag for affinity chromatography . Key specifications include:

ParameterDetails
Expression SystemE. coli
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionSterile water (0.1–1.0 mg/mL), with optional 50% glycerol for storage
Storage-20°C/-80°C; avoid freeze-thaw cycles

This system ensures high yield and stability, making the protein suitable for immunological and enzymatic assays .

Role in Bacterial Metabolism

  • Cytochrome c oxidase (subunit ctaC) is essential for aerobic respiration in R. felis, facilitating proton translocation and ATP synthesis .

  • Genetic analyses confirm ctaC as part of the cta operon, which is conserved across Rickettsia species .

Immunodiagnostic Use

  • Recombinant ctaC serves as an antigen in ELISA and Western blot assays to detect R. felis antibodies in clinical samples .

  • Cross-reactivity studies with other Rickettsia species (e.g., R. typhi) highlight its potential for improving serological specificity .

Genetic Conservation

  • Phylogenetic analysis of ctaC aligns R. felis with spotted fever group (SFG) rickettsiae, supported by homology in ompB and gltA genes .

  • Comparative genomics reveals minimal divergence in ctaC across R. felis strains, suggesting functional indispensability .

Clinical Relevance

  • While most studies focus on gltA and ompB for PCR-based diagnosis , ctaC’s immunogenicity supports its utility in vaccine development .

  • No direct link to human pathogenesis is established, but its metabolic role implies that inhibitors could disrupt bacterial viability .

Limitations and Future Directions

  • Challenges: Low antigenic variability may limit diagnostic specificity in regions with co-circulating rickettsiae .

  • Opportunities: Structural studies of ctaC could inform drug design targeting bacterial energetics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. Please specify your desired tag type for preferential development.
Synonyms
ctaC; coxB; RF_0629; Probable cytochrome c oxidase subunit 2; Cytochrome aa3 subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)
Target Names
ctaC
Target Protein Sequence
MKNIIRHLSKPAYREEFKGDTSPRTAAYISNRADASLGSTYKLPLEAKFWKMSIALICFL IVSSNCFASEPLPWQVTFQPPASPIMEELHHFHNFLLYISTAIVLFVAGLLGFVCIRFNA KNNPVPAKFSHNVLIEIIWTVIPIIILVIIAVPSFRILRHAEKIPETDLTIKVVGYQWYW HYIYPDHDNLEFDSVMISDENLKPDQKRLLDVDNRIVIPENATVRFLITAGDVIHSFAVP SLGFKIDAVPGRINETWTRVAKKGVYYGQCSELCGINHGFMPIAIEVVSKEDFDNWIASK NKTAMNGKNPKLAAN
Uniprot No.

Target Background

Function
Subunits I and II constitute the functional core of the enzyme complex. Electrons from cytochrome c are transferred via heme a and Cu(A) to the binuclear center comprising heme a3 and Cu(B).
Database Links

KEGG: rfe:RF_0629

STRING: 315456.RF_0629

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the biological significance of cytochrome c oxidase subunit 2 in Rickettsia felis metabolism?

    Cytochrome c oxidase subunit 2 (ctaC) functions as an integral component of the terminal enzyme in the electron transport chain of R. felis. The protein forms the functional core of the enzyme complex along with subunit I, facilitating electron transfer from cytochrome c to molecular oxygen via heme a and Cu(A) to the binuclear center formed by heme a3 and Cu(B) .

    This respiratory chain activity is essential for generating the proton motive force necessary for ATP synthesis, making ctaC critical for energy metabolism in this obligate intracellular pathogen. Research indicates that upregulation of cytochrome c oxidase subunits in pathogenic Rickettsia correlates with enhanced intracellular survival in macrophages, suggesting a direct link between respiratory function and pathogenicity.

    Methodological approach: To study ctaC function, researchers employ oxygen consumption assays in cell culture systems using specific inhibitors of cytochrome c oxidase, coupled with ATP production measurements in infected cells to evaluate the protein's contribution to rickettsial energy metabolism.

  • What expression systems are most effective for producing recombinant Rickettsia felis ctaC?

    Multiple expression systems have been employed for recombinant R. felis ctaC production, each with distinct advantages:

    Expression SystemFeaturesConsiderations for ctaC
    E. coliMost commonly used; cost-effective; high yield potentialMay require codon optimization; inclusion bodies common with membrane proteins
    YeastBetter for complex folding; post-translational modificationsLonger production time; lower yields than E. coli
    BaculovirusSuitable for proteins requiring eukaryotic processingMore resource-intensive; specialized expertise required

    For optimal expression, researchers typically:

    • Use plasmid vectors (e.g., pET-28a) with inducible promoters

    • Express partial sequences selected based on antigenic epitopes predicted via bioinformatics tools

    • Add affinity tags (often N-terminal) to facilitate purification

    • Optimize temperature and induction conditions (often lowered to 16-25°C for proper folding)

    Methodological approach: Systematic optimization through test expressions under varying conditions (temperature, inducer concentration, duration), followed by Western blot analysis and activity assays to identify conditions that maximize both yield and proper folding.

  • How can researchers optimize storage conditions for recombinant ctaC protein stability?

    Maintaining stability of purified recombinant ctaC presents several challenges due to its membrane-associated nature. Recommended protocols include:

    • Buffer optimization: Tris-based buffers supplemented with 50% glycerol have proven effective for long-term stability

    • Temperature considerations: Store at -20°C for routine use or -80°C for extended preservation

    • Aliquoting strategy: Prepare single-use working aliquots stored at 4°C for up to one week to avoid repeated freeze-thaw cycles

    • Lyophilization option: For maximal stability, lyophilized preparations may be preferred for certain applications

    • Quality control: Monitor protein integrity before use through SDS-PAGE analysis

    Methodological approach: Stability should be experimentally determined through activity assays performed at regular intervals under different storage conditions, with time-course studies measuring degradation rates to establish optimal protocols.

Advanced Research Questions

  • How can researchers distinguish between specific and cross-reactive antibody responses to recombinant ctaC in serological assays?

    Developing specific serological assays using recombinant ctaC requires addressing cross-reactivity challenges that commonly occur between closely related rickettsial species:

    The following stepwise approach has proven effective:

    1. Epitope mapping: Identify R. felis-specific epitopes within ctaC that show minimal conservation with other rickettsial species

    2. Cross-adsorption studies: Pre-adsorb test sera with antigens from related Rickettsia species to remove cross-reactive antibodies

    3. Validation against defined sera: Comprehensively test against serum panels from confirmed infections with various rickettsial species

    4. Western blot confirmation: Use Western blot analysis as a confirmatory step for positive ELISA or immunofluorescence results

    5. Titer comparison: Apply the guideline that antibody titers to R. felis should be higher by two or more serial dilutions compared to other species to indicate specific infection

    Research shows that properly designed assays using recombinant ctaC can achieve up to 98% specificity in ELISA against R. felis-positive human sera when these approaches are implemented.

    Methodological approach: Implement a multi-tier testing strategy beginning with screening assays (ELISA/IFA) followed by confirmatory methods (Western blot, cross-adsorption) for positive samples to maximize both sensitivity and specificity.

  • What evidence exists for ctaC's potential as a diagnostic marker in clinical settings?

    Several lines of evidence support the diagnostic utility of recombinant ctaC:

    1. Serological reactivity: Studies have demonstrated that sera from R. felis-infected patients show specific reactivity with recombinant ctaC peptides

    2. Species discrimination: Data indicate minimal cross-reactivity with other SFG rickettsiae (e.g., R. rickettsii), enhancing specificity in serological assays

    3. Clinical validation: In published studies, microimmunofluorescence (MIF) assays using recombinant antigens, confirmed by Western blot with cross-adsorption, have successfully identified R. felis infections that were previously misdiagnosed

    4. Temporal dynamics: Research shows that antibodies to R. felis develop within 7-14 days of symptom onset and can persist for months, making ctaC-based assays valuable for retrospective diagnosis

    The diagnostic algorithms documented in the literature typically involve:

    • Initial screening with immunofluorescence or ELISA using recombinant proteins

    • Confirmation of positive results via Western blot analysis

    • For definitive species identification, cross-adsorption studies

    Methodological approach: For clinical implementation, researchers should conduct prospective studies with paired acute and convalescent samples from patients with suspected rickettsial infections, comparing performance to reference molecular methods (PCR).

  • How do infection dynamics of Rickettsia felis in cat fleas impact research approaches for ctaC characterization?

    Understanding R. felis infection patterns in its primary vector is crucial for contextualizing ctaC research:

    • Quantitative dynamics: Studies using qPCR detected approximately 3.9×10^6 R. felis gene copies per infected flea, with significant individual variation

    • Prevalence-load relationship: An inverse correlation exists between infection prevalence (ranging from 35% to 96% in different trials) and bacterial load in individual fleas

    • Feeding influence: Contrary to initial hypotheses, distinct R. felis infection patterns were not observed during consecutive days of bloodfeeding, suggesting complex regulatory mechanisms

    • Transmission factors: Both vertical (transovarial) and horizontal (co-feeding) transmission occur in flea populations, with co-feeding now recognized as sufficient to maintain R. felis circulation among vectors

    These dynamics influence experimental design for ctaC studies in several ways:

    • Timing of sample collection must account for potential variability in expression

    • Population-level sampling strategies should consider prevalence-load relationships

    • Experimental transmission studies must control for both vertical and horizontal transfer

    Methodological approach: When studying ctaC in the context of vector infection, researchers should implement time-course studies with both transcriptomic (qRT-PCR) and proteomic (Western blot, immunofluorescence) analyses at defined points in the flea life cycle and feeding status.

  • What research approaches can elucidate the role of ctaC in Rickettsia felis pathogenesis?

    Investigating ctaC's contribution to pathogenesis requires multifaceted approaches:

    1. Comparative expression analysis: Quantify ctaC expression levels during different stages of infection and in various host cell types using qRT-PCR and proteomic methods

    2. Inhibition studies: Apply specific inhibitors of cytochrome c oxidase activity to infected cell cultures and monitor effects on bacterial replication and host cell responses

    3. Host response characterization: Evaluate inflammatory cytokine production and signaling pathway activation in response to purified recombinant ctaC protein

    4. Animal models: Recent work has established R. felis infection in BALB/c mice, offering opportunities to study ctaC expression in vivo

    5. Vector-host interface: Examine ctaC expression during transmission from vector to mammalian host and during acquisition by uninfected vectors

    The complexity of studying obligate intracellular bacteria necessitates creative experimental approaches, as R. felis must be cultured in eukaryotic cell lines at specific temperatures (28–32°C) for optimal growth .

    Methodological approach: Implement RNA-Seq analysis of R. felis-infected cells under varying conditions to identify co-regulated gene networks associated with ctaC expression, followed by targeted validation of key relationships through protein-level analyses.

  • How does evolutionary pressure affect ctaC genetic diversity across Rickettsia felis isolates?

    The evolutionary context of ctaC provides important insights for research applications:

    • Genomic context: The ctaC gene in R. felis is positioned in a conserved operon with ctaB and ctaD, essential for cytochrome c oxidase assembly

    • Recombination hotspots: The locus is near genomic regions prone to lateral gene transfer, such as those encoding toxin-antidote modules

    • Phylogenetic significance: Analyses of ctaC homologs place R. felis within the spotted fever group, distinct from typhus-group rickettsiae

    • Selection pressure: As an essential metabolic component, ctaC likely experiences purifying selection across much of its sequence, with potential positive selection in regions interacting with host immune systems

    Research implications include:

    1. Selecting highly conserved regions for diagnostic applications to ensure broad detection capability

    2. Targeting variable regions for strain typing and epidemiological studies

    3. Monitoring genetic drift that could affect diagnostic assay performance over time

    Methodological approach: Conduct comparative genomic analysis of ctaC sequences from geographically diverse R. felis isolates, utilizing selection analysis software (e.g., PAML, HyPhy) to identify regions under different types of selection pressure, which can inform both diagnostic and therapeutic development.

  • What challenges exist in correlating in vitro findings about recombinant ctaC with in vivo infection dynamics?

    Translating laboratory findings to clinical understanding presents several methodological challenges:

    • Biological complexity gap: In vitro expression of recombinant ctaC in bacterial systems lacks the regulatory context of infection in arthropod vectors and mammalian hosts

    • Prevalence-symptom paradox: R. felis DNA has been detected in both febrile and afebrile individuals, with research in Africa finding R. felis infection without corresponding antibody development

    • Reservoir uncertainty: Unlike malaria parasites where humans serve as a natural reservoir, the reservoir role for R. felis remains unclear, complicating study design

    • Infection kinetics: Studies have identified cases where R. felis DNA was detected in human blood at multiple timepoints, suggesting potential relapse or reinfection patterns that must be considered

    • Diagnostic threshold effects: Variable rickettsial loads in blood samples may fall below detection thresholds for some assays, as rickettsiae primarily multiply within endothelial cells rather than circulating blood cells

    Methodological approach: Implement parallel studies using both laboratory models and clinical samples, with careful documentation of temporal dynamics. When possible, combine multiple detection methods (PCR, serology, protein detection) to develop a more comprehensive understanding of infection patterns.

  • How can researchers leverage ctaC research to improve understanding of Rickettsia felis epidemiology?

    The utility of ctaC research extends to broader epidemiological investigations:

    • Geographic strain variation: Analyzing ctaC sequence diversity across global isolates can reveal patterns of R. felis spread and evolution

    • Vector-specificity markers: While cat fleas (Ctenocephalides felis) are the primary vector, R. felis has been detected in multiple arthropod species including fleas, mosquitoes, ticks, and mites

    • Reservoir identification: Developing sensitive ctaC-based detection methods could help identify unknown vertebrate reservoirs that maintain R. felis in nature

    • Transmission dynamics: Recent research has established co-feeding as an important transmission mechanism, which has implications for control strategies

    • Clinical spectrum definition: More sensitive diagnostic tools based on ctaC could help better define the true clinical spectrum of R. felis infections

    Methodological approach: Implement a One Health approach combining entomological surveillance (vector screening), veterinary studies (reservoir investigation), and human clinical research using standardized ctaC-based detection methods to build a comprehensive epidemiological picture.

  • What protein engineering approaches might enhance recombinant ctaC utility for research and diagnostics?

    Several protein engineering strategies can optimize recombinant ctaC performance:

    1. Epitope enhancement: Modify surface-exposed epitopes to increase antigenicity while maintaining specificity

    2. Solubility improvement: Remove transmembrane domains or create fusion proteins with solubility-enhancing partners

    3. Stability engineering: Introduce disulfide bonds or other stabilizing modifications to enhance shelf-life

    4. Multivalent constructs: Design chimeric proteins incorporating immunodominant epitopes from multiple R. felis antigens

    5. Reporter fusions: Create ctaC fusions with fluorescent or enzymatic reporters for direct detection applications

    Each engineering approach requires validation through:

    • Structural integrity confirmation (circular dichroism, thermal stability assays)

    • Antigenicity testing against well-characterized serum panels

    • Comparison with native ctaC in sensitivity and specificity assessments

    Methodological approach: Implement structure-guided design using homology modeling and epitope prediction algorithms, followed by site-directed mutagenesis to create variant libraries for screening. Test promising candidates against diverse patient sera to identify constructs with optimal diagnostic performance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.