Recombinant Rickettsia felis Probable intracellular septation protein A (RF_0613)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

The recombinant form of RF_0613 is typically expressed in Escherichia coli with a His-tag for purification . Key production details include:

ParameterSpecification
Expression SystemE. coli
TagN-terminal His-tag (determined during production)
Storage BufferTris-based buffer with 50% glycerol
StabilityStable at -20°C long-term; working aliquots stable at 4°C for ≤1 week

Commercial vendors such as Creative BioMart and Anagnostics offer this protein for research use, with prices exceeding $1,500 per 50 µg .

Diagnostic Development

RF_0613 is utilized in ELISA-based assays to detect R. felis infections. Its immunogenicity makes it a candidate for serological testing . For example:

  • A study in China used R. felis-specific PCR and serological tools to confirm infections in patients with pneumonia, highlighting the need for reliable diagnostic antigens like RF_0613 .

Phylogenetic Analysis

RF_0613’s gene sequence has contributed to phylogenetic studies placing R. felis within the spotted fever group (SFG) of rickettsiae. Genetic analyses of gltA, ompB, and 17-kDa genes corroborate this classification .

Challenges and Opportunities

  • Knowledge Gaps: The exact mechanism of RF_0613 in septation remains unverified, requiring structural or mutagenesis studies .

  • Diagnostic Potential: Cross-reactivity with typhus group rickettsiae (e.g., R. typhi) complicates serological specificity, necessitating further validation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your requests whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery estimates, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own formulations.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
yciB; RF_0613; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)
Target Names
RF_0613
Target Protein Sequence
MLKLLSEIGPVIAFFAGFFYGGGIQNATLYMLITSVICITLCYVIDKKVSKLSIISTTVL LVSGSITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKYALESIVRLKEESWIIL SYRTAAFFFFMAVVNEIVWRNFSDETWVKFKVFGVIPVTFIFILLQLPLLLKNKLPDSKI
Uniprot No.

Target Background

Function
This protein plays a role in cell envelope biogenesis, maintenance of cell envelope integrity, and membrane homeostasis.
Database Links

KEGG: rfe:RF_0613

STRING: 315456.RF_0613

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the predicted function of RF_0613 in Rickettsia felis?

RF_0613 (Probable intracellular septation protein A) likely plays a crucial role in the binary fission process of Rickettsia felis. As an obligate intracellular bacterium, R. felis relies on septation proteins to orchestrate the cell division process. Similar to other intracellular bacteria, RF_0613 likely participates in the formation of the divisome, a multi-protein complex that forms at the division plane and orchestrates the steps necessary for septal peptidoglycan synthesis and cell division . The protein may be involved in facilitating chromosome segregation and septal formation during bacterial replication within host cells.

How does RF_0613 compare to septation proteins in other Rickettsia species?

While specific comparative data for RF_0613 across Rickettsia species isn't provided in the search results, we can make informed inferences based on evolutionary relationships. Rickettsia species, including R. felis and R. conorii, share similar intracellular lifestyles and division mechanisms . The function of RF_0613 likely parallels that of homologous proteins in related species, though with potential adaptations specific to R. felis' ecological niche and host interactions. Unlike the well-characterized outer membrane protein A (ompA) in R. conorii that elicits protective immunity , RF_0613's immunogenic properties remain less characterized, presenting an opportunity for comparative analysis across rickettsial species.

What is the relationship between RF_0613 and the divisome complex?

RF_0613, as a probable septation protein, likely participates in the divisome complex formation during binary fission. The divisome is essential for obligate intracellular bacteria, orchestrating chromosome segregation, peptidoglycan synthesis, and mid-cell constriction . Based on studies in model organisms, the divisome forms at the division plane and contains multiple proteins that coordinate to ensure proper cell division. RF_0613 presumably contributes to this complex, potentially interacting with FtsZ filaments that undergo treadmilling at the septum, driving the rotational movement necessary for positioning peptidoglycan biosynthetic enzymes at the division plane .

What expression systems are most effective for producing recombinant RF_0613?

For recombinant production of RF_0613, E. coli expression systems similar to those used for other Rickettsia proteins offer a practical approach. Based on protocols for related rickettsial proteins, such as the recombinant R. conorii ompA , researchers should consider:

  • Vector selection: Plasmids containing N-terminal tags (His-SUMO) and C-terminal tags (Myc) can facilitate purification and detection

  • Expression conditions: Optimization of temperature, induction duration, and IPTG concentration is crucial

  • Solubility enhancement: Using solubility-enhancing tags like SUMO may improve yield of functional protein

The resulting recombinant protein should be verified through SDS-PAGE, with expected purity greater than 85% .

What are the challenges in designing primers for RF_0613 amplification?

Designing primers for RF_0613 amplification presents several research challenges:

  • Sequence conservation: Primers must target conserved regions to ensure specificity while accounting for potential sequence variations among Rickettsia isolates

  • GC content: Rickettsia genomes typically have low GC content, requiring careful primer design to ensure optimal annealing temperatures

  • Secondary structures: Potential secondary structures in the target region may inhibit efficient amplification

  • Cross-reactivity: Primers must avoid cross-reactivity with host genomic material, especially when amplifying from infected samples

For optimal results, researchers should design primers with melting temperatures between 55-65°C, include GC clamps at 3' ends, and validate specificity using in silico analysis against related Rickettsia species sequences.

How can protein-protein interactions of RF_0613 be studied in the context of the divisome?

Studying RF_0613's protein-protein interactions within the divisome complex requires specialized approaches due to the obligate intracellular nature of Rickettsia. Recommended methodologies include:

  • Bacterial two-hybrid systems: Modified for use with rickettsial proteins to detect interactions with other divisome components

  • Co-immunoprecipitation: Using tagged recombinant RF_0613 to pull down interaction partners from cellular extracts

  • Proximity labeling techniques: BioID or APEX2 fusions to RF_0613 can identify proximal proteins in the native environment

  • Fluorescence microscopy: Colocalization studies using fluorescently tagged RF_0613 and known divisome proteins like FtsZ

These approaches should be complemented with in silico prediction of interaction domains based on sequence analysis and structural modeling compared to better-characterized divisome proteins in model organisms like E. coli .

How does RF_0613 contribute to FtsZ treadmilling during cell division?

RF_0613 may interact with the FtsZ filament system that undergoes treadmilling during bacterial cell division. FtsZ filaments play dual roles in recruiting division proteins and generating contractile forces for mid-cell constriction . The treadmilling process involves assembly of GTP-bound FtsZ at one end of the filament while disassembly occurs at the other end following GTP hydrolysis .

As a probable septation protein, RF_0613 might:

  • Stabilize FtsZ polymers at the division site

  • Regulate the GTPase activity of FtsZ, affecting treadmilling rates

  • Serve as an adaptor between the FtsZ cytoskeleton and other divisome components

  • Participate in positioning peptidoglycan biosynthetic enzymes that follow the treadmilling motion

The exact mechanisms would require specific experimental verification using in vitro reconstitution systems with purified components or high-resolution microscopy in appropriate cellular models.

What role might RF_0613 play in the pathogenesis of Rickettsia felis infections?

RF_0613's potential role in pathogenesis stems from its function in bacterial replication. While not directly an immunogenic surface protein like ompA , its contribution to cell division could influence:

  • Bacterial load: Efficient septation facilitates faster multiplication within host cells, potentially increasing pathogen burden

  • Antibiotic susceptibility: Septation proteins are potential targets for novel antimicrobials; understanding RF_0613 could inform therapeutic development

  • Host cell manipulation: The division process of intracellular bacteria may trigger host responses through pathogen-associated molecular patterns

  • Urban transmission dynamics: As R. felis has been identified in urban environments , efficient replication enabled by RF_0613 could contribute to its emerging status in urban settings

Research indicates R. felis circulates in urban areas, with Rhipicephalus sanguineus ticks potentially involved in transmission . The protein's role in bacterial replication may influence this epidemiological pattern.

How do nucleoid occlusion systems interact with RF_0613 during Rickettsia cell division?

The interaction between nucleoid occlusion systems and RF_0613 represents a sophisticated regulatory mechanism in bacterial cell division. Nucleoid occlusion prevents chromosome bisection during septation by inhibiting divisome assembly over chromosomal DNA . In model organisms like E. coli, the SlmA protein binds specific chromosomal sequences and prevents FtsZ assembly in these regions .

For RF_0613 research, important considerations include:

  • Potential binding interactions between RF_0613 and nucleoid occlusion proteins

  • Temporal coordination of RF_0613 localization relative to chromosome segregation

  • Spatial regulation mechanisms that position RF_0613 at appropriate septation sites

  • The impact of disrupting these interactions on chromosome segregation fidelity

Methodological approaches might include ChIP-seq to identify binding sites of nucleoid occlusion proteins, super-resolution microscopy to visualize the spatial relationship between RF_0613 and the nucleoid, and protein-protein interaction studies to identify direct binding partners.

What purification strategies yield the highest activity for recombinant RF_0613?

Purification of recombinant RF_0613 requires careful optimization to maintain functional activity. Based on strategies for similar rickettsial proteins , a recommended purification workflow includes:

  • Affinity chromatography: Using the N-terminal His tag for initial capture on Ni-NTA resin

  • Tag removal: SUMO protease cleavage to remove the solubility-enhancing tag

  • Size exclusion chromatography: Further purification and buffer exchange into a stabilizing formulation

  • Activity preservation: Storage in Tris-based buffer with 50% glycerol as used for other rickettsial proteins

Researchers should verify purity by SDS-PAGE (>85%) and conduct activity assays specific to septation proteins, such as GTPase stimulation assays if RF_0613 interacts with FtsZ.

How can researchers differentiate between RF_0613 and homologous proteins in other Rickettsia species?

Distinguishing RF_0613 from homologous proteins in other Rickettsia species requires multiple complementary approaches:

  • Sequence-based differentiation:

    • Multiple sequence alignment to identify species-specific residues

    • Design of species-specific PCR primers targeting divergent regions

    • Development of antibodies against unique epitopes

  • Functional characterization:

    • Comparative binding assays with potential interaction partners

    • Species-specific activity assays based on biochemical functions

    • Cross-complementation studies in appropriate model systems

  • Structural analysis:

    • Computational modeling to predict structural differences

    • Limited proteolysis to identify differentially exposed regions

    • Circular dichroism spectroscopy to detect variations in secondary structure

These approaches are particularly important given the close evolutionary relationships among Rickettsia species and the potential for cross-reactivity in experimental systems .

What are the optimal conditions for assessing RF_0613 activity in vitro?

Assessing RF_0613 activity in vitro requires careful consideration of physiological conditions. Recommended parameters include:

  • Buffer composition: Tris-based buffers (pH 7.4-7.6) containing physiological salt concentrations (150 mM NaCl) and divalent cations (5-10 mM MgCl₂) to support protein-protein interactions and potential enzymatic activities

  • Temperature: 30-37°C to mimic the physiological environment of Rickettsia within mammalian hosts

  • Interaction partners: Inclusion of potential binding partners, particularly components of the divisome complex like FtsZ

  • Energy sources: ATP and/or GTP (1-5 mM) may be required if RF_0613 has ATPase/GTPase activity or interacts with nucleotide-binding proteins

Activity can be monitored through various methods including light scattering to detect protein polymerization, GTPase activity assays if RF_0613 affects FtsZ function, or FRET-based approaches to detect conformational changes upon binding.

How might RF_0613 contribute to the development of novel anti-rickettsial therapies?

RF_0613's role in cell division presents compelling opportunities for therapeutic development:

  • Target validation: As a probable septation protein, RF_0613 likely represents an essential function for bacterial replication, making it a promising drug target

  • High-throughput screening: The recombinant protein could be used in biochemical assays to screen for small molecule inhibitors

  • Structure-based drug design: Once the protein structure is determined, rational design approaches can identify molecules that interfere with key functional domains

  • Peptide inhibitors: Designed peptides that mimic interaction interfaces could disrupt RF_0613's associations with other divisome components

Given the emergence of rickettsial pathogens in urban environments , developing targeted therapies against fundamental replication processes could address an important public health need.

What insights might RF_0613 research provide about bacterial evolution and adaptation?

Research on RF_0613 can provide valuable evolutionary insights:

  • Comparative genomics: Analysis of RF_0613 homologs across Rickettsia species can reveal selective pressures and evolutionary adaptation signatures

  • Host-pathogen co-evolution: Variations in septation proteins may reflect adaptation to different host environments

  • Intracellular lifestyle adaptations: As an obligate intracellular bacterium, R. felis may have evolved specialized division mechanisms adapted to the host cytoplasmic environment

  • Horizontal gene transfer: Analysis of RF_0613 sequence may reveal evidence of genetic exchange events that contributed to rickettsial evolution

These evolutionary insights could explain differences in pathogenicity, host range, and transmission dynamics among Rickettsia species found in both urban and sylvatic cycles .

How does RF_0613 function differ between laboratory and field isolates of Rickettsia felis?

Understanding potential differences in RF_0613 between laboratory-adapted and field isolates of R. felis represents an important research direction:

  • Sequence variation: Field isolates may harbor polymorphisms in RF_0613 that affect function or interactions

  • Expression levels: Transcriptomics and proteomics approaches could reveal differential expression patterns between isolates

  • Fitness impact: Growth kinetics in cell culture models might demonstrate functional consequences of variations

  • Geographic distribution: Different urban or ecological settings may select for variations in cell division proteins

Research approaches should include:

  • Sequencing RF_0613 from diverse geographic isolates

  • Site-directed mutagenesis to recreate field variants for functional testing

  • Competition assays between isolates under different growth conditions

  • Structural analysis to determine how variations might impact protein function

This research would be particularly valuable given the emerging importance of R. felis in urban settings and indoor environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.