Recombinant Rickettsia felis Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rickettsia felis SecD

SecD is a core subunit of the Sec translocase complex, which facilitates the transport of polypeptides across the cytoplasmic membrane in bacteria. In Rickettsia felis, an obligate intracellular pathogen, the Sec system enables secretion of virulence factors and survival within host cells. The recombinant form (Uniprot ID: Q4UKW3) is produced for research applications, including structural studies and antibody development .

Biological Role in the Sec Translocase

The SecD subunit operates within the SecDF subcomplex, which regulates substrate secretion into the periplasm. Key functional insights include:

  • Energy coupling: Collaborates with SecA ATPase to drive polypeptide translocation via proton motive force .

  • Membrane topology: Contains 12 transmembrane segments and a large periplasmic domain critical for substrate release .

  • Species specificity: Rickettsia SecD likely differs from homologs in Escherichia coli, as observed with chimeric SecA constructs in functional studies .

Challenges and Future Directions

Current gaps include:

  • Structural resolution of Rickettsia SecD and its interaction with SecYEG.

  • Role in pathogenicity: Whether SecD directly modulates host interactions or effector secretion.

  • Antibiotic targeting potential, leveraging Sec system conservation across pathogens .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
secD; RF_0959; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-518
Protein Length
full length protein
Species
Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)
Target Names
secD
Target Protein Sequence
MQNLPKWKIFLSIICTVFAVICALPNFMQVNSKFLPHDSVNLGLDLRGGAHLLLDVDFDT YLNDSMENLADTLRKNFREDKIGYKNLLVRQNSIQLEVRSPEELKPLKKIINKIDPEIIA EVNENKIKLSYSESRLNDLLNKVVDQSIEIVRMRVDSTGTKEPTLQKQGDKHILLQVPGE ENPSYLKNILGKTAKLTFHLVDENANIEEAVKGHVPVGSMLVKGDSESHREYYVVIKKKV VLGGDQLTTASASFDQNSQAVVAFSFNNLGSKIFGEITKNNTGKRLAIVLDNKLLSAPTI NGAIMGGSGIITGNFTVESANELALLLRAGSLPAPLKIIEERSIGPSLGADSIESGKKAG LIGFIAVCIFMVWSYGVLGLFANIALSLALLYILALLSLFQATLTLPGIAGIILTMGMAV DANVLIYERIKEELHKGVSNLYAIRTGFESAFATILDSNLTTLIVAFLLYIFGVGAIKGF AVALTIGIISSMFSAIIITKLLIDIWVKYFIPKKLGLV
Uniprot No.

Target Background

Function
SecD is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
Database Links

KEGG: rfe:RF_0959

STRING: 315456.RF_0959

Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rickettsia felis and what is the significance of studying its SecD protein?

Rickettsia felis is an etiologic agent of spotted fever that belongs to the spotted fever group rickettsiae (SFGR). It is primarily maintained in cat fleas through vertical transmission . The protein translocase subunit SecD is part of the bacterial secretion machinery essential for protein transport across cellular membranes, making it critical for bacterial viability and potentially its pathogenicity. Studying SecD provides insights into R. felis pathogenesis mechanisms, potential drug targets, and fundamental aspects of bacterial protein secretion in obligate intracellular bacteria .

How does SecD function in the bacterial secretion pathway?

SecD functions as part of the bacterial Sec translocase complex, which is responsible for transporting proteins across or into membranes. Specifically, SecD works in conjunction with SecF (often forming a SecDF complex) to enhance protein translocation efficiency by utilizing the proton motive force to drive protein movement. The complex is involved in both the release of translocated proteins from the SecYEG channel and the regulation of protein translocation dynamics. In R. felis, SecD likely plays a critical role in the secretion of virulence factors and essential proteins required for survival within host cells .

What methods are most effective for recombinant expression of R. felis SecD protein?

Recombinant expression of R. felis SecD is challenging due to its multiple transmembrane domains. Based on available information and related bacterial protein expression systems, the following methodological approach is recommended:

  • Expression System Selection: E. coli strains specialized for membrane protein expression (C41/C43) or eukaryotic systems like insect cells for proper folding

  • Vector Design:

    • Include affinity tags (His6, GST) for purification

    • Use inducible promoters (T7, tac) for controlled expression

    • Consider fusion partners to enhance solubility

  • Expression Conditions:

    • Lower induction temperatures (16-20°C)

    • Reduced inducer concentrations

    • Extended expression times (24-48 hours)

  • Membrane Protein Extraction:

    • Detergent screening (DDM, LDAO, OG)

    • Gentle lysis methods

  • Purification Strategy:

    • Immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography

    • Ion exchange chromatography

For the SecD protein specifically, maintaining the native conformation is critical for functional studies, so detergent selection during purification is particularly important for preserving membrane protein integrity .

What are the optimal storage conditions for recombinant R. felis SecD protein?

Based on the product information, recombinant R. felis SecD protein should be stored following these guidelines:

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week

  • Medium-term storage: Store at -20°C

  • Long-term storage: Store at -20°C or -80°C

  • Buffer composition: Tris-based buffer with 50% glycerol, optimized for protein stability

  • Handling precautions: Avoid repeated freeze-thaw cycles as they can lead to protein denaturation and loss of activity

What cell culture systems are suitable for studying R. felis and its secretion systems?

Research indicates several cell culture systems are appropriate for R. felis studies:

Cell LineOriginTemperature RangeAdvantagesLimitations
ISE6Ixodes scapularis (tick)32°CHigh permissivity, supports isolation and propagation without centrifugationRequires specialized media
VeroCercopithecus aethiops (monkey)28-32°CSupports R. felis growth at controlled temperaturesLimited growth at temperatures above 32°C
XTC-2Xenopus laevis (frog)28°CHigh permissivity for some R. felis strainsGrowth only at lower temperatures
C6/36Aedes albopictus (mosquito)28°CSuccessful for isolation of R. felis Pedreira strainLimited temperature range

The ISE6 tick cell line has been particularly successful for cultivation of the LSU strain of R. felis, enabling studies without requiring centrifugation techniques or temperature shifts that were previously thought necessary. This suggests conserved arthropod-derived factors may facilitate rickettsial infection and replication in these cells .

How can researchers distinguish between different strains of R. felis in experimental systems?

Distinguishing between R. felis strains requires molecular characterization techniques targeting specific genetic differences:

  • Gene Amplification and Sequencing:

    • Citrate synthase (gltA)

    • 16S rRNA

    • 17-kDa genus-specific antigen

    • Outer membrane protein A (ompA)

    • Conjugative plasmids (pRF)

  • Plasmid Detection:

    • PCR amplification of plasmid-specific sequences

    • Restriction enzyme digestion patterns analysis

  • Growth Characteristics Assessment:

    • Temperature requirements

    • Cell line preferences

    • Cytopathic effects (e.g., LSU strain causes increased vacuolization)

  • Whole Genome Sequencing:

    • Identification of strain-specific single nucleotide polymorphisms

    • Detection of genomic rearrangements

    • Analysis of plasmid presence/absence patterns

Research has identified distinct differences between the LSU strain and other isolates like Marseille-URRWXCal2 and Pedreira strains, particularly in their growth requirements and genetic composition .

How can researchers evaluate the functionality of recombinant R. felis SecD protein?

Evaluating SecD functionality requires specialized assays targeting protein translocation activity:

  • In vitro translocation assays:

    • Reconstitution of purified SecD with other Sec components in proteoliposomes

    • Measurement of ATP hydrolysis rates during protein translocation

    • Fluorescence-based assays tracking movement of labeled preproteins

  • Complementation studies:

    • Expression of R. felis SecD in SecD-deficient bacterial strains

    • Assessment of growth restoration under conditions requiring functional Sec machinery

  • Proton motive force coupling:

    • Measurement of proton gradient utilization

    • Assessing protein movement in the presence of protonophores

  • Site-directed mutagenesis:

    • Creation of specific amino acid substitutions in conserved domains

    • Evaluation of effects on translocation efficiency and substrate specificity

  • Interaction assays:

    • Co-immunoprecipitation with other Sec pathway components

    • Crosslinking studies to identify nearest neighbors in the translocation complex

These methodological approaches provide insights into both the basic function of SecD and its specific role in R. felis biology and pathogenesis .

What is known about the interaction between SecD and SecF in R. felis?

While specific experimental data on R. felis SecD-SecF interactions is limited, comparative analysis with other bacterial systems suggests:

  • Complex Formation:

    • SecD and SecF likely form a functional complex (SecDF)

    • The complex spans the bacterial membrane

    • Both proteins are encoded in the R. felis genome (gene names secD and secF, locus tags RF_0959 and RF_1179 respectively)

  • Functional Interdependence:

    • SecD function is often dependent on SecF and vice versa

    • The complex works together in the later stages of protein translocation

    • Both contribute to proton motive force utilization

  • Structural Relationship:

    • Based on R. felis SecD (518 aa) and SecF (308 aa) sequences, they likely form complementary structures

    • The proteins may have pseudo-symmetrical arrangements in the membrane

  • Methodological Approaches to Study Interaction:

    • Co-expression systems for both proteins

    • Bacterial two-hybrid assays

    • Förster resonance energy transfer (FRET) with fluorescently labeled proteins

    • Cryo-electron microscopy of the reconstituted complex

Further experimental work specifically on R. felis SecDF complex would be valuable to confirm these predicted interactions based on homology to better-studied bacterial systems .

How can R. felis SecD be targeted for antimicrobial development?

As an essential component of the bacterial secretion machinery, SecD represents a potential target for novel antimicrobials against R. felis and related pathogens:

  • Target Validation Approaches:

    • Conditional knockdown systems to confirm essentiality

    • Identification of critical functional domains through mutagenesis

    • Determination of minimum inhibitory concentrations (MICs) of known Sec inhibitors

  • Drug Discovery Strategies:

    • High-throughput screening of compound libraries against purified SecD

    • Structure-based drug design utilizing SecD modeling

    • Fragment-based approaches targeting functional pockets

    • Peptidomimetic inhibitors based on natural substrates

  • Proposed Inhibition Mechanisms:

    • Disruption of SecD-SecF complex formation

    • Interference with proton translocation pathway

    • Blockage of substrate binding sites

    • Allosteric inhibition altering conformational changes

  • Evaluation Systems:

    • In vitro protein translocation assays with potential inhibitors

    • R. felis growth inhibition in cell culture systems

    • Synergistic effects with existing antibiotics

This research direction could lead to novel therapeutics against rickettsial diseases, particularly important as R. felis is an emerging pathogen causing febrile illness in Africa and other regions .

What role might SecD play in rickettsial pathogenesis and host-pathogen interactions?

SecD likely plays multiple roles in R. felis pathogenesis through its function in protein secretion:

  • Virulence Factor Secretion:

    • The Sec pathway may secrete proteins involved in host cell invasion

    • Transport of immunomodulatory factors to evade host defenses

    • Secretion of proteins required for intracellular survival and replication

  • Membrane Protein Integration:

    • SecD assists in the insertion of surface proteins that mediate host cell attachment

    • Membrane proteins involved in nutrient acquisition from host cells

    • Transporters required for intracellular survival

  • Contribution to Cell Biology:

    • SecD function affects bacterial envelope integrity

    • May influence susceptibility to host antimicrobial peptides

    • Could impact bacterial stress responses in hostile host environments

  • Research Approaches:

    • Comparative proteomics of wild-type vs. SecD-depleted bacteria

    • Identification of SecD-dependent secreted proteins by mass spectrometry

    • Host cell transcriptomics in response to bacteria with altered SecD function

    • In vivo models examining virulence of SecD-attenuated strains

The unique adaptation of R. felis to different arthropod hosts (both fleas and potentially ticks) may involve specialized functions of secretion systems including SecD .

What are common challenges in working with recombinant R. felis SecD and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant R. felis SecD:

ChallengeCauseSolution Strategies
Low expression yieldMembrane protein toxicity, codon biasUse specialized expression strains (C41/C43), codon optimization, tightly regulated expression systems
Protein misfoldingImproper membrane insertion, aggregationLower expression temperatures, membrane-mimetic environments during purification
Protein insolubilityHydrophobic transmembrane domainsScreen multiple detergents (DDM, OG, LDAO), use lipid nanodiscs or amphipols
Loss of activity during purificationDetergent-induced conformational changesUse milder detergents, add lipids during purification, employ gentle elution conditions
Aggregation during storageProtein instabilityInclude glycerol in storage buffer, add specific lipids, store in small aliquots
Difficulty in functional assaysComplex multi-component systemReconstitute with partner proteins (SecF), include proper lipid compositions

Implementing these strategies can significantly improve research outcomes when working with this challenging membrane protein .

How can researchers verify the authenticity and purity of recombinant R. felis SecD preparations?

Verification of R. felis SecD authenticity and purity requires multiple analytical approaches:

  • SDS-PAGE Analysis:

    • Verification of expected molecular weight (~56 kDa)

    • Assessment of sample purity

    • Detection of potential degradation products

  • Western Blotting:

    • Using anti-tag antibodies if tagged protein is used

    • Using specific anti-SecD antibodies if available

    • Verification of full-length protein presence

  • Mass Spectrometry:

    • Peptide mass fingerprinting

    • Sequence coverage analysis

    • Identification of post-translational modifications

    • Absolute purity assessment

  • Size Exclusion Chromatography:

    • Evaluation of protein homogeneity

    • Detection of aggregation state

    • Assessment of complex formation with detergent/lipid

  • Functional Assays:

    • ATPase activity measurements

    • Protein translocation capacity

    • SecF binding studies

  • Circular Dichroism:

    • Secondary structure verification

    • Thermal stability assessment

    • Conformational integrity evaluation

Implementing these analytical methods ensures that subsequent experimental results are based on properly characterized protein preparations .

How does R. felis SecD compare to SecD proteins in other bacterial pathogens?

Comparative analysis of R. felis SecD with other bacterial pathogens reveals important evolutionary and functional relationships:

Bacterial SpeciesSecD Protein SimilarityKey DifferencesFunctional Implications
Escherichia coliModerate sequence homologyE. coli SecD is larger with additional domainsE. coli model may not fully represent R. felis SecD function
Other Rickettsia spp.High sequence conservation (>90%)Minor variations in surface-exposed regionsConserved function within genus, potential species-specific interactions
Orientia tsutsugamushiModerate-high similarityReduced genome size affects secretion system complexityConvergent adaptations for intracellular lifestyle
Mycobacterium tuberculosisLow-moderate similarityAdditional SecD domains, different membrane compositionDifferent drug targeting potential
Chlamydia spp.Moderate similarityStreamlined secretion systemsSimilar adaptations for obligate intracellular lifestyle

These comparisons suggest that while core SecD functions are conserved across bacteria, R. felis SecD likely has adaptations specific to its unique ecological niche and pathogenic lifestyle as an arthropod-transmitted intracellular pathogen .

What insights can be gained from studying the Sec pathway in R. felis compared to other bacterial secretion systems?

Studying the Sec pathway in R. felis provides unique insights due to several distinguishing features:

  • Evolutionary Adaptations:

    • R. felis has a reduced genome compared to free-living bacteria

    • Selective pressure has retained essential Sec components despite genome reduction

    • Comparison reveals minimum requirements for functional protein secretion

  • Host-Adaptation Mechanisms:

    • The Sec pathway in R. felis must function in diverse environments (arthropod vector and mammalian host)

    • Temperature-dependent regulations may exist (28-32°C optimal growth)

    • Adaptations for the intracellular lifestyle reflect specialized secretion requirements

  • Unique Features:

    • R. felis possesses conjugative plasmids that may encode additional secreted factors

    • The interplay between chromosomal and plasmid-encoded secreted proteins

    • Potential specialized Sec-dependent substrates for arthropod colonization

  • Comparative Research Approaches:

    • Heterologous expression of R. felis SecD in model systems

    • Complementation studies in Sec-deficient bacterial strains

    • Substrate specificity analysis comparing R. felis with other bacterial systems

These investigations can reveal fundamental principles of bacterial secretion system evolution and specialization in the context of host-pathogen interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.