Recombinant Rickettsia felis Putative sensor histidine kinase ntrY-like (RF_0427)

Shipped with Ice Packs
In Stock

Description

Functional Role in Rickettsia felis

RF_0427 is critical for bacterial adaptation to host environments. Key findings include:

  • Two-Component Signaling: RF_0427 autophosphorylates at a conserved histidine residue and transfers the phosphate to RF_0895, regulating gene expression in response to stress .

  • Genetic Context: The RF_0427 gene is located on the R. felis chromosome, which encodes 1,512 proteins—the largest genome among sequenced Rickettsia species .

  • Conjugative Transfer: RF_0427 shares homology with histidine kinases in Agrobacterium tumefaciens’s T4SS (Type IV Secretion System), suggesting a role in plasmid transfer .

Recombinant Production and Applications

Recombinant RF_0427 is commercially available for research (e.g., MyBioSource, Creative BioMart) . Technical specifications include:

ParameterDetails
Expression VectorpET or pQE-based plasmids
PurificationNickel-affinity chromatography
StorageLyophilized powder in Tris/PBS buffer (6% trehalose, pH 8.0) at -80°C
ApplicationsAntibody development, enzymatic assays, structural studies

Experimental studies using recombinant RF_0427 have focused on:

  • Kinase Activity Assays: Measuring ATP hydrolysis and phosphotransfer to RF_0895 .

  • Host-Pathogen Interactions: Identifying interactions with arthropod histone H2B, which facilitates R. felis internalization .

Research Gaps and Future Directions

Despite advances, critical questions remain:

  • Mechanistic Insights: The exact environmental signals activating RF_0427 are unknown .

  • Therapeutic Potential: Targeting RF_0427 could disrupt R. felis survival, but no inhibitors have been developed .

  • Evolutionary Links: RF_0427’s homology to plasmid-borne TCS in other bacteria suggests horizontal gene transfer events .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted to customer needs.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RF_0427; Putative sensor histidine kinase NtrY-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-599
Protein Length
full length protein
Species
Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)
Target Names
RF_0427
Target Protein Sequence
MLSYLKKNLRSYFSSRVLIFTLAIAAIIFACATFYVISLESKNFSTIIGFLLVDLAIFLI LGVLLTQKFFTQNSNNDSSKLQNRIVIAFSLVAAIPTIIVSVFSVYFFNLSVQAWFDKKI STVLDQSVIVAESYIAEHKLQLKETALAVAEDLSDMYYDLIHNPALFTKTLNTEAEMRSL DEAIVLNKSTNTIVANSYLSFSLSFATIPAHLIKKADLGEPVEVKSDPTKIRMLIKLKEY NDVYLLVGRLVDNKIIDHIDATNGAAAEYNSLKNEIDNIQIKFSIMFIFIALLLLFVAIS FGVIFTAKIVKPIKKLVTATDKVKDGDLTVQVPENEVDKDEIGTLYAAFNRMIKQLSRQQ RDLVIAQRAMAWSDVAKKVAHEIKNPLTPILLASERLLKKFSPEIKEKEEFENYLKMIIR HTNDIKNIVSEFVLFARLPAPKFTKSELVYLVKHIVEARKLLNDNILYKFESNVDQFDFM CDATQINQVMINLLKNAEESIEGRESGKIEVTIDAKDDFISVIVIDSGKGFPPELIGKAT ESYVTTSSKGMGVGLAIVKRIVEEHCGILDIANREEEGAIIDIKFDLKKLDLKVGRSGG
Uniprot No.

Target Background

Function
Member of the two-component regulatory system RF_0427/RF_0895.
Database Links

KEGG: rfe:RF_0427

STRING: 315456.RF_0427

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Rickettsia felis Putative sensor histidine kinase ntrY-like (RF_0427)?

Recombinant Rickettsia felis Putative sensor histidine kinase ntrY-like (RF_0427) is a full-length protein (599 amino acids) that functions as a sensor histidine kinase within a two-component signal transduction system. The protein (UniProt ID: Q4UMD4) is produced as a recombinant construct with an N-terminal His-tag, expressed in E. coli, and typically supplied as a lyophilized powder for research purposes . This protein belongs to the broader class of sensor histidine kinases that participate in bacterial signal transduction, allowing organisms to respond to environmental stimuli through phosphorylation cascades involving a paired response regulator protein.

Two-component systems typically consist of two fundamental protein units: a sensor histidine kinase (HK) like RF_0427 and a response regulator (RR). The HK acts as the primary sensor that detects environmental signals and initiates the signaling cascade through autophosphorylation, followed by phosphotransfer to the response regulator . As a putative NtrY-like protein, RF_0427 likely participates in nitrogen regulation or related metabolic processes within Rickettsia felis.

How should RF_0427 protein be stored and reconstituted for optimal activity?

For optimal preservation of RF_0427 protein activity, researchers should follow these methodological guidelines:

Storage recommendations:

  • Store the lyophilized powder at -20°C to -80°C upon receipt

  • After reconstitution, prepare working aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% is recommended) and store at -20°C to -80°C

Reconstitution protocol:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to the desired final concentration for long-term storage

  • Prepare small aliquots to minimize freeze-thaw cycles

Proper storage and reconstitution are critical for maintaining the structural integrity and functional activity of the protein, as histidine kinases are known to be sensitive to repeated freeze-thaw cycles, which can disrupt the protein's tertiary structure and compromise enzymatic activity.

How does the domain architecture of RF_0427 relate to its function in signal transduction?

The domain architecture of RF_0427, like other sensor histidine kinases, directly relates to its signal transduction mechanism through a series of conformational changes and phosphorylation events. Understanding this relationship requires detailed knowledge of structure-function correlations:

The functional mechanism can be described through distinct conformational states:

  • Sensing state: The transmembrane and HAMP domains detect environmental signals, causing conformational changes

  • Autokinase state (State A): The CA domain, loaded with ATP, must reorient to approach the conserved histidine in the DHp domain of the opposing protomer for trans-autophosphorylation. In this state, the interface between DHp and CA domains must be destabilized to allow movement

  • Phosphotransfer state (State B): After histidine phosphorylation, the CA domain relaxes to a conformation that exposes the phosphorylated histidine for interaction with the response regulator. This facilitates phosphotransfer to the aspartate residue in the response regulator

  • *Phosphatase state (State A)**: A distinct conformation that enables dephosphorylation of the phosphorylated response regulator, often dependent on sensor input and the presence of nucleotide

The interface between the DHp and CA domains is crucial for regulation, as evidenced by mutational studies in related histidine kinases like EnvZ. Mutations in this interface can separate kinase and phosphatase activities, demonstrating that interdomain contacts are essential for controlled signal transduction .

Table 1: Key Domain Interactions in Histidine Kinase Function

Domain InterfaceBuried Surface Area (Ų)Key ResiduesFunctional Significance
DHp-CA Interface1250Hydrophobic residues at interfaceControls switching between kinase and phosphatase activities
DHp Contribution525α1a and α2 helicesForms part of the interface with CA domain
CA Contribution475α3 helix, G2 box, F boxATP binding and catalytic activity
Linker Region250Residues connecting domainsFacilitates conformational changes between states

This structural arrangement ensures that RF_0427 can cycle between its various functional states in response to environmental stimuli, allowing precise control of downstream signaling pathways .

What experimental approaches are most effective for studying RF_0427 phosphorylation activity?

Studying the phosphorylation activity of RF_0427 requires carefully designed experimental approaches that address the multifunctional nature of histidine kinases. Based on established protocols for similar proteins, the following methodological framework is recommended:

1. Autophosphorylation Assays:

  • Incubate purified RF_0427 with [γ-³²P]ATP in appropriate buffer conditions

  • Terminate reactions at various time points using SDS sample buffer

  • Analyze by SDS-PAGE followed by autoradiography to detect phosphorylated protein

  • Include controls with heat-inactivated protein and ATP without radioactive label

2. Phosphotransfer Assays:

  • First perform autophosphorylation as described above

  • Add purified cognate response regulator protein

  • Monitor phosphotransfer kinetics by taking samples at different time points

  • Analyze the decrease in RF_0427 phosphorylation and increase in response regulator phosphorylation

3. Phosphatase Activity Assessment:

  • Pre-phosphorylate the response regulator (either chemically or enzymatically)

  • Add unphosphorylated RF_0427 and appropriate nucleotides (ADP or ATP)

  • Monitor the dephosphorylation of the response regulator over time

Experimental Design Considerations:

When designing these experiments, researchers should control for the following variables that might affect phosphorylation kinetics:

VariableControl MethodImportance
TemperatureMaintain constant temperature (typically 25-37°C)Affects enzyme kinetics and protein stability
pHUse appropriate buffer systems (typically pH 7.0-8.0)Influences protein conformation and activity
Divalent cationsInclude Mg²⁺ or Mn²⁺ at appropriate concentrationsEssential cofactors for ATP binding and hydrolysis
Reducing agentsAdd DTT or β-mercaptoethanolPrevents oxidation of cysteine residues
Protein concentrationStandardize concentrations across experimentsAffects reaction kinetics
Nucleotide concentrationUse consistent ATP/ADP concentrationsSubstrate for kinase/phosphatase activities

These experimental approaches should be integrated with structural studies (X-ray crystallography, NMR, or cryo-EM) to correlate functional data with conformational states described in the literature for similar histidine kinases .

How can mutagenesis be used to investigate the signal transduction mechanism of RF_0427?

Site-directed mutagenesis represents a powerful approach to dissect the signal transduction mechanism of RF_0427 by targeting specific residues involved in key functional activities. Based on structural and functional studies of related histidine kinases, a systematic mutagenesis strategy should focus on the following regions:

1. Conserved Histidine Residue:

  • Identify and mutate the conserved histidine residue that serves as the phosphoacceptor (typically in the DHp domain)

  • Create H→A or H→Q mutations to eliminate phosphorylation capacity

  • These mutations should abolish both autokinase and phosphotransfer activities while potentially preserving phosphatase activity

2. ATP-Binding Pocket Residues:

  • Target conserved residues in the CA domain involved in ATP binding (N, G1, F, G2 boxes)

  • Create mutations that affect ATP binding affinity or positioning

  • These mutations may selectively affect autokinase activity while potentially preserving phosphotransfer and phosphatase functions

3. DHp-CA Interface Residues:

  • Based on the structural data from related histidine kinases, mutate key residues at the interdomain interface

  • Focus on hydrophobic residues that contribute to the buried surface area

  • These mutations may differentially affect kinase and phosphatase activities, as seen in the X motif of EnvZ

4. HAMP Linker Mutations:

  • Introduce mutations in the HAMP domain to investigate signal transmission from the sensor to the catalytic regions

  • Include both point mutations and insertion/deletion mutations to alter the helical register

  • These mutations can reveal how conformational changes propagate through the protein

Experimental Design Framework:

Mutation TypeTarget ResiduesExpected OutcomeAnalytical Methods
PhosphoacceptorConserved HisLoss of phosphorylationPhosphorylation assays, in vivo complementation
Catalytic residuesATP-binding pocketAltered kinase activityATP binding assays, kinase assays
Interface residuesDHp-CA interfaceAltered balance of activitiesAll three enzyme activity assays
Linker residuesHAMP domainAltered signal transductionIn vivo signaling assays, conformational studies

After generating the mutants, researchers should conduct a comprehensive functional analysis, including:

  • In vitro enzymatic assays to assess autokinase, phosphotransfer, and phosphatase activities

  • Conformational analysis using techniques such as limited proteolysis, fluorescence spectroscopy, or hydrogen-deuterium exchange

  • In vivo complementation studies to evaluate the biological significance of the mutations

This systematic approach can reveal the molecular mechanisms underlying signal transduction and identify residues critical for each function, similar to studies done with EnvZ that distinguished residues required for kinase versus phosphatase activities .

What experimental design is optimal for studying RF_0427 interaction with its cognate response regulator?

Studying the interaction between RF_0427 and its cognate response regulator requires a multi-faceted experimental design that addresses both physical interaction and functional coupling. The following methodological framework provides a systematic approach:

1. Identification of the Cognate Response Regulator:

  • Genomic context analysis to identify potential response regulators encoded near the RF_0427 gene

  • Bioinformatic analysis of conserved gene neighborhoods in related Rickettsia species

  • Phylogenetic profiling to identify co-evolved histidine kinase-response regulator pairs

2. Physical Interaction Studies:

TechniqueApplicationAdvantagesLimitations
Bacterial two-hybridIn vivo detection of protein-protein interactionsWorks in cellular contextPotential false positives
Co-immunoprecipitationPull-down of interacting proteinsDetects native complexesRequires antibodies
Surface plasmon resonanceReal-time binding kineticsQuantitative binding parametersRequires protein immobilization
Isothermal titration calorimetryThermodynamic binding parametersLabel-free, solution-basedRequires substantial protein amounts
Protein crosslinkingCaptures transient interactionsCan detect weak interactionsMay introduce artifacts

3. Functional Interaction Assays:

  • Phosphotransfer profiling with multiple potential response regulators to identify specific pairs

  • Competition assays to determine binding specificity and preference

  • Phosphotransfer kinetics to quantify the efficiency of signal transmission

Experimental Design Framework:

When designing these experiments, researchers should follow these five key steps as outlined in general experimental design principles:

  • Define variables clearly:

    • Independent variable: Different response regulator candidates or mutants

    • Dependent variable: Binding affinity, phosphotransfer efficiency, or complex formation

    • Control variables: Buffer conditions, temperature, protein concentrations

  • Formulate specific, testable hypotheses:

    • "RF_0427 will preferentially phosphorylate response regulator X compared to response regulators Y and Z"

    • "Mutation of residue A in RF_0427 will decrease binding affinity but not phosphotransfer efficiency"

  • Design controlled experimental treatments:

    • Include proper controls (non-cognate response regulators, inactive mutants)

    • Maintain consistent experimental conditions

    • Use multiple technical and biological replicates

  • Assign appropriate group comparisons:

    • Between-conditions comparisons (different response regulators)

    • Within-protein comparisons (wild-type vs. mutant proteins)

  • Plan precise measurement of dependent variables:

    • Use quantitative methods with appropriate sensitivity

    • Implement standardized protocols to ensure reproducibility

    • Apply statistical analyses to determine significance

This comprehensive experimental design will provide robust data on both the physical and functional interactions between RF_0427 and its cognate response regulator, essential for understanding the complete signal transduction pathway.

How can researchers effectively analyze phosphorylation kinetics of RF_0427?

Analyzing the phosphorylation kinetics of RF_0427 requires precise experimental techniques and appropriate data analysis methods to characterize the rates of autophosphorylation, phosphotransfer, and dephosphorylation. The following methodological framework provides a comprehensive approach:

1. Quantitative Phosphorylation Assays:

For accurate kinetic analysis, researchers should employ time-course experiments with the following considerations:

  • Use radiolabeled ATP ([γ-³²P]ATP) or fluorescently-labeled ATP analogs for detection

  • Collect samples at appropriate time intervals (seconds to minutes) to capture the initial rate

  • Ensure reaction conditions are consistent (temperature, pH, ionic strength)

  • Include proper controls to account for background and non-specific phosphorylation

2. Data Analysis Approaches:

Kinetic ParameterExperimental ApproachAnalysis Method
Autophosphorylation rate (k₁)Time course with excess ATPInitial velocity determination, fit to first-order or pseudo-first-order kinetics
ATP binding affinity (Km)Varying ATP concentrationsMichaelis-Menten kinetic analysis
Phosphotransfer rate (k₂)Pre-phosphorylated HK with RRBi-molecular reaction kinetics, second-order rate constant
Phosphatase rate (k₃)Pre-phosphorylated RR with HKFirst-order decay kinetics

3. Mathematical Models for Kinetic Analysis:

For autophosphorylation, the reaction can be modeled as:
HK+ATPHKP+ADPHK + ATP \rightarrow HK\sim P + ADP

The rate equation follows pseudo-first-order kinetics (with excess ATP):
d[HKP]dt=k1[HK][ATP]kobs[HK]\frac{d[HK\sim P]}{dt} = k_1[HK][ATP] \approx k_{obs}[HK]

For phosphotransfer:
HKP+RRHK+RRPHK\sim P + RR \rightarrow HK + RR\sim P

The rate equation follows second-order kinetics:
d[RRP]dt=k2[HKP][RR]\frac{d[RR\sim P]}{dt} = k_2[HK\sim P][RR]

4. Integration of Multiple Datasets:

To obtain a comprehensive understanding of RF_0427 kinetics, researchers should:

  • Combine data from multiple experimental approaches

  • Use global fitting of datasets to constrain parameters

  • Develop mathematical models that incorporate all three activities (kinase, phosphotransfer, phosphatase)

  • Compare kinetic parameters across different conditions or mutations

5. Addressing Technical Challenges:

Several methodological challenges must be addressed:

  • Rapid kinetics may require stopped-flow techniques for accurate measurement

  • Protein stability during reactions must be monitored

  • Background hydrolysis of phosphohistidine must be accounted for

  • Potential oligomerization states must be considered in kinetic models

By implementing this systematic approach to kinetic analysis, researchers can obtain detailed mechanistic insights into the functional cycle of RF_0427, including rate-limiting steps and the effects of regulatory signals on each activity stage.

What strategies can be used to study the structural dynamics of RF_0427 during signal transduction?

Understanding the structural dynamics of RF_0427 during signal transduction requires sophisticated experimental approaches that capture conformational changes across different functional states. The following methodological framework provides a comprehensive strategy:

1. Solution-Based Structural Techniques:

2. Structural Stabilization Strategies:

To capture specific conformational states, researchers should employ:

  • Nucleotide analogs:

    • ATP analogs (AMP-PNP, ATPγS) to trap the ATP-bound state

    • ADP to stabilize the post-hydrolysis state

  • Phosphomimetic approaches:

    • Phosphohistidine analogs or mimics to simulate the phosphorylated state

    • Beryllofluoride (BeF₃⁻) to simulate phosphorylated response regulator

  • Protein engineering:

    • Disulfide crosslinking to trap specific conformations

    • Introduction of fluorescent labels at key positions for FRET studies

    • Generation of truncated constructs focusing on specific domains

3. Molecular Dynamics Simulations:

Computational approaches can complement experimental methods:

  • Atomistic molecular dynamics simulations to model conformational changes

  • Targeted molecular dynamics to simulate transitions between known states

  • Normal mode analysis to identify potential domain movements

  • Coarse-grained simulations to access longer timescales relevant to domain motions

4. Integrated Structural Biology Approach:

Researchers should integrate multiple techniques in a cohesive experimental design:

Based on studies of related histidine kinases, researchers should focus on:

  • The DHp-CA domain interface, which changes during the catalytic cycle

  • The region surrounding the phosphoacceptor histidine

  • The HAMP domain and its connection to the DHp domain

  • The ATP-binding pocket in different nucleotide-bound states

This integrated approach will provide insights into how environmental signals are transmitted through RF_0427 to initiate phosphorylation cascades, ultimately leading to appropriate cellular responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.