Recombinant Rickettsia felis SURF1-like protein (RF_0175)

Shipped with Ice Packs
In Stock

Description

Overview of Rickettsia felis SURF1-like protein (RF_0175)

Rickettsia felis is an emergent pathogen belonging to the transitional group of rickettsiae . First described in 1990, R. felis infections have been reported worldwide . R. felis infection in humans can be mistaken for other viral and bacterial infections like dengue fever . Patients infected with R. felis may present symptoms such as fever, headache, chills, cough, cutaneous rash, nausea, vomiting, and weakness .

RF_0175 is a SURF1-like protein in Rickettsia felis. Genes whose closest nonrickettsial matches were eukaryotic genes were designated “XYZ-like" . Predicted proteins with unknown functions were placed in this category .

Surface-Exposed Proteins of Rickettsia

Rickettsia rickettsii, the agent of Rocky Mountain spotted fever, is the most pathogenic member among Rickettsia species . Surface-exposed proteins (SEPs) of R. rickettsii may play roles in its pathogenesis or immunity . In one study, R. rickettsii organisms were surface-labeled with sulfo-NHS-SS-biotin, and the labeled proteins were affinity-purified with streptavidin . The proteins were separated by two-dimensional electrophoresis, and 10 proteins were identified among 23 protein spots by electrospray ionization tandem mass spectrometry . Five of the 10 proteins (OmpA, OmpB, GroEL, GroES, and a DNA-binding protein) were previously characterized as surface proteins of R. rickettsii . Another 5 proteins (Adr1, Adr2, OmpW, Porin_4, and TolC) were first recognized as SEPs of R. rickettsii .

Rickettsia felis Outer Membrane Protein A (OmpA)

R. felis has been proposed as a member of the transitional group phylogenetically positioned between the spotted fever group (SFG) and the typhus group . A characteristic of the SFG and transitional group is the presence of the gene encoding outer membrane protein A (ompA) . R. felis possesses a truncated ompA because of premature stop codons in its sequence . OmpA is an immunodominant protein involved in the rickettsia–host cell attachment process . Despite the presence of premature stop codons, the R. felis ompA gene has some open reading frames, and there is active transcription of segments of the gene, suggesting the possibility of protein translation and the presence of OmpA in the cytoplasm of R. felis .

Genetic Differentiation of Rickettsia felis

The predicted digestion by NlaIV produced the following fragment lengths :

  • R. asembonensis: 2 bands of 490 and 323 base pairs (bp)

  • Candidatus R. senegalensis: 2 bands of 683 and 130 bp

  • R. felis: 1 band of 813 bp

  • R. typhi: 2 bands of 760 and 53 bp

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; this may serve as a helpful reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
RF_0175; SURF1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)
Target Names
RF_0175
Target Protein Sequence
MKTNLVVLITFTILISLGFWQLSRLKEKKLFLASMQANLTSPAINLAEIQDSLPYHKVKI TGQFLPNKDIYLYGRRSMSSGKDGYYLVTPFKTIEDKVILVARGWFSNRNKIIITQATND RQHEIIGVTMPSEKTRSYLPANDIKNNVWLTLDLKEASQTLELNLEDFYIIAEGKDISNL DILLPLSINHLAAIRNDHLEYALTWFGLAISLIVIYVIYRRNVISV
Uniprot No.

Target Background

Database Links

KEGG: rfe:RF_0175

STRING: 315456.RF_0175

Protein Families
SURF1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for recombinant RF_0175?

For optimal preservation of recombinant RF_0175, researchers should adhere to these protocols:

  • Store at -20°C for routine storage

  • For extended preservation, conserve at -20°C or -80°C

  • Maintain working aliquots at 4°C for up to one week

  • Avoid repeated freezing and thawing cycles, as this can degrade protein integrity

  • The protein is typically supplied in a Tris-based buffer containing 50% glycerol, optimized specifically for RF_0175 stability

How does RF_0175 relate to SURF1 proteins in other organisms?

RF_0175 belongs to the SURF1 protein family, with notable differences from mammalian SURF1 proteins:

  • While mammalian SURF1 is known for its role in cytochrome c oxidase (COX) assembly and mitochondrial function, the precise function of bacterial SURF1-like proteins remains less characterized

  • SURF1 mutations in humans cause Leigh syndrome, a severe neurological disorder affecting the central nervous system

  • Unlike RF_0175, mammalian SURF1 is critical for neuronal development and function, particularly in neurogenesis

  • SURF1 dysfunction in mammals leads to bioenergetic defects that impair neural progenitor cells (NPCs) and disrupt neuronal maturation and firing activity

  • Bacterial SURF1-like proteins likely evolved from common ancestral proteins but have diverged significantly in function based on the different physiological requirements of prokaryotes compared to eukaryotes

What methods are used to express and purify recombinant RF_0175?

Standard recombinant expression and purification protocols for RF_0175 typically include:

  • Gene Cloning:

    • Amplification of the RF_0175 gene using PCR with specific primers targeting the region encoding amino acids 1-226

    • Cloning into an appropriate expression vector (e.g., PCRT7/Topo TA NT or similar vectors with inducible promoters)

  • Expression Systems:

    • Utilization of E. coli expression systems (e.g., BL21(DE3)pLysS) for bacterial expression

    • Induction of protein expression using IPTG or similar inducers

  • Purification Strategy:

    • Metal affinity chromatography using Ni-NTA columns for His-tagged proteins

    • The tag type may be determined during the production process based on experimental requirements

    • Buffer optimization to maintain protein stability during purification

  • Quality Control:

    • SDS-PAGE analysis to confirm protein size and purity

    • Western blot verification using anti-His tag antibodies or specific antibodies against RF_0175

    • Mass spectrometry to confirm protein identity

How can RF_0175 be used in immunological assays for Rickettsia felis detection?

RF_0175 offers potential applications in serological diagnostics, with the following experimental approaches:

  • ELISA Development:

    • Coat plates with purified recombinant RF_0175 (50-100 ng/well)

    • Block with appropriate blocking buffer (e.g., 1-5% BSA or non-fat milk)

    • Test patient sera at various dilutions (typically 1:100 to 1:1000)

    • Detect using enzyme-conjugated secondary antibodies and appropriate substrates

    • Include positive and negative controls to establish assay validity

  • Western Blot Analysis:

    • Load 100 μg of recombinant RF_0175 on SDS-PAGE gels

    • Transfer to nitrocellulose membranes by electroblotting

    • Block with TBST containing 1% non-fat milk

    • Incubate with patient sera and appropriate controls

    • Develop using enzyme-conjugated secondary antibodies

  • Validation Considerations:

    • Cross-reactivity assessment against sera from patients with related diseases (dengue, leptospirosis, other rickettsial infections)

    • Sensitivity and specificity determination using confirmed positive and negative samples

    • Correlation with established diagnostic methods (PCR, IFA)

Research has shown that recombinant rickettsial proteins can be used for specific serological diagnosis, potentially differentiating R. felis infections from other rickettsial diseases .

What experimental models are suitable for studying RF_0175 function?

Several experimental models can be employed to investigate RF_0175 function:

  • Cell Culture Systems:

    • Mammalian cell lines susceptible to R. felis infection (e.g., Vero cells, L929 cells)

    • Flea-derived cell lines to study vector-pathogen interactions

    • Comparative infection studies using wild-type and RF_0175-mutant R. felis strains

  • Arthropod Models:

    • Cat fleas (Ctenocephalides felis) - the primary vector and reservoir of R. felis

    • Experimental flea feeding systems to study transmission dynamics

    • Immunofluorescence-based detection of R. felis in flea tissues, particularly salivary glands

  • Genetic Manipulation Approaches:

    • Transposon mutagenesis of the RF_0175 gene to study loss-of-function effects

    • Complementation studies to verify phenotype restoration

    • Heterologous expression systems to study protein function outside the rickettsial context

  • Infection Models:

    • Animal models for R. felis infection (limited by the lack of a robust disease model)

    • Ex vivo tissue systems to study host-pathogen interactions

What is known about the role of RF_0175 in Rickettsia felis pathogenesis?

Current understanding of RF_0175's role in R. felis pathogenesis is limited, but several hypotheses can be formulated based on related research:

  • Membrane Association:

    • The amino acid sequence of RF_0175 suggests it may be membrane-associated, potentially involved in interactions with host cells or vector tissues

    • The protein contains hydrophobic regions consistent with membrane integration

  • Vector Interactions:

    • R. felis shows distinct localization patterns in flea salivary glands, suggesting specialized protein-mediated interactions

    • Related Rickettsia species utilize surface proteins for vector colonization

  • Host Cell Interactions:

    • SURF1-like proteins may contribute to energy metabolism in the intracellular environment

    • They could be involved in adaptation to different host environments (arthropod vector vs. mammalian host)

  • Clinical Manifestations:

    • R. felis infections present with fever, headache, chills, cough, rash, and sometimes pneumonia

    • Four cases of R. felis infection identified in China between 2021-2022 all developed pneumonia or lung lesions, suggesting potential respiratory involvement that might relate to bacterial proteins like RF_0175

Further research using genetic manipulation of RF_0175 in R. felis would be necessary to establish its specific roles in pathogenesis.

How does RF_0175 compare to other important antigenic proteins of Rickettsia felis?

RF_0175 represents one of several potential antigenic proteins in R. felis, with important distinctions:

ProteinFunctionAntigenic PropertiesDiagnostic Potential
RF_0175 (SURF1-like)Unknown; potentially involved in metabolismUnder investigationBeing explored
OmpACell adhesion; involved in host-cell attachmentImmunodominant; contains specific epitopesRecombinant peptides can distinguish R. felis from other rickettsial infections
OmpBMajor surface antigenHighly immunogenicCommonly used for PCR-based detection
17-kD proteinSurface proteinConserved among rickettsiaeUsed for genus-specific detection

Notably, while OmpA is truncated in R. felis due to premature stop codons, it remains partly transcribed and potentially translated. Research has demonstrated that recombinant peptides representing regions of OmpA can be recognized by sera from R. felis-infected patients but not by sera from patients with other rickettsial infections, suggesting specificity that might also apply to RF_0175 .

What challenges exist in developing RF_0175 as a diagnostic target for R. felis infections?

Several challenges must be addressed when developing RF_0175 as a diagnostic tool:

  • Serological Cross-Reactivity:

    • R. felis antigens may cross-react with antibodies against other rickettsial species

    • Careful epitope selection and assay validation is necessary to ensure specificity

  • Temporal Dynamics of Antibody Response:

    • The kinetics of anti-RF_0175 antibody development during infection is unknown

    • May require paired serum samples to detect seroconversion

  • Genetic Variation:

    • Potential strain variation in RF_0175 sequences could affect diagnostic sensitivity

    • Heterogeneity in rickettsial protein sequences, even within the same geographic area, has been documented

  • Technical Limitations:

    • Current diagnosis of R. felis infection requires molecular methods (PCR and sequencing)

    • Limited availability of these technologies in endemic regions hampers diagnosis

    • Simplification of diagnostic approaches is needed for field implementation

  • Clinical Similarity to Other Diseases:

    • R. felis infection presents similarly to other febrile illnesses like dengue and leptospirosis

    • Differential diagnosis requires specific and sensitive tools

How might structural analysis of RF_0175 inform vaccine or therapeutic development?

Structural characterization of RF_0175 could advance vaccine and therapeutic strategies through multiple approaches:

  • Epitope Mapping:

    • Identification of surface-exposed regions that may serve as B-cell epitopes

    • Characterization of conserved epitopes across R. felis strains

    • Determination of epitopes that elicit neutralizing antibodies

  • Structure-Function Relationships:

    • Crystal or cryo-EM structures could reveal functional domains

    • Identification of potential active sites or interaction interfaces

    • Understanding of membrane integration and topology

  • Comparative Structural Analysis:

    • Comparison with mammalian SURF1 structures could reveal unique features for targeted intervention

    • Identification of structural elements shared with other rickettsial proteins

  • Rational Drug Design:

    • Identification of druggable pockets or cavities

    • Virtual screening of compound libraries against RF_0175 structure

    • Design of peptidomimetics or small molecules that interfere with RF_0175 function

  • Vaccine Antigen Development:

    • Selection of stable, immunogenic domains for subunit vaccine formulation

    • Design of chimeric antigens incorporating multiple protective epitopes

    • Structure-guided stabilization of native conformations

What research gaps remain in our understanding of RF_0175?

Significant knowledge gaps persist regarding RF_0175, presenting opportunities for innovative research:

  • Functional Characterization:

    • The precise biological function of RF_0175 remains unknown

    • Whether it shares functional characteristics with mammalian SURF1 proteins

    • Its role in bacterial metabolism or host interaction

  • Expression Patterns:

    • Temporal expression profile during infection cycle

    • Expression differences between growth in arthropod vectors versus mammalian hosts

    • Transcriptional and translational regulation mechanisms

  • Protein Interactions:

    • Host cellular or molecular targets

    • Interactions with other rickettsial proteins

    • Formation of potential protein complexes

  • Immunological Relevance:

    • Natural immunogenicity during human infection

    • Protective potential of anti-RF_0175 antibodies

    • Role in evading or modulating host immune responses

  • Genetic Manipulation:

    • Phenotypic effects of RF_0175 knockout or mutation

    • Complementation studies to confirm gene-phenotype relationships

    • Potential as an antimicrobial target

Current research methodologies including transposon mutagenesis, which has been successfully applied to other R. felis genes like sca1, could be adapted to study RF_0175 function in flea infection models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.