Recombinant Rickettsia felis Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Gene Context

The petA gene encodes the iron-sulfur subunit of Complex III, which facilitates electron transfer between ubiquinol and cytochrome c. In Rickettsia felis, this subunit is essential for maintaining redox balance during oxidative phosphorylation. The recombinant form is produced via heterologous expression systems, such as E. coli, yeast, or cell-free platforms, to study its structural, functional, and immunological properties.

Key Gene Attributes:

ParameterDetails
Gene NamepetA
Alternative NamesRieske iron-sulfur protein (RISP)
EC NumberEC 1.10.2.2
Host SystemsE. coli, yeast, baculovirus, mammalian cells, or cell-free systems
Purity≥85% as determined by SDS-PAGE

Source:

Production and Purification

Recombinant petA is synthesized using prokaryotic or eukaryotic expression systems, depending on post-translational modification requirements. Purity is standardized to ≥85% via SDS-PAGE, ensuring minimal contaminant proteins.

Production Platforms:

Host SystemApplications
E. coliHigh-yield production for structural studies or immunological assays
Yeast/BaculovirusProper folding of eukaryotic-like proteins (e.g., disulfide bonds)
Cell-Free ExpressionRapid synthesis without cellular constraints

Source:

Research Gaps and Challenges

The available literature lacks detailed functional studies on Rickettsia felis petA. Key unresolved questions include:

  1. Structural Determinants: How the Rieske domain in R. felis petA differs from homologs in other Rickettsia species.

  2. Pathogenicity Link: Potential role in host-pathogen interactions or immune evasion.

  3. Therapeutic Targets: Whether petA inhibition could disrupt R. felis energy metabolism.

Limitations in Current Data:

  • No peer-reviewed studies directly investigating R. felis petA’s biochemical properties.

  • Recombinant petA products are primarily listed as research tools without experimental validation.

Source:

Clinical and Diagnostic Relevance

While not directly cited in the provided sources, recombinant proteins like petA could theoretically aid in:

  • Antigen Detection: Serological assays to distinguish R. felis infections from other rickettsial pathogens.

  • Vaccine Development: As a component in subunit vaccines targeting R. felis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
petA; RF_1010; Ubiquinol-cytochrome c reductase iron-sulfur subunit; Rieske iron-sulfur protein; RISP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)
Target Names
petA
Target Protein Sequence
MSDTEDNKNKQTTRRDFMVLTASSVAAVGAVCTLWPLVDSLNPSADVLALSSIEVDLSNI AVGQTVTVKWQGKPVFITNRTPDKIAEARAVKMSELIDPETDEARVKAGHDNWLVTIGIC THLGCVPLANQGEYDGWFCPCHGSQYDSSGRVRRGPAPLNLAVPPYTFISDKKIRIG
Uniprot No.

Target Background

Function

Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), a respiratory chain component vital for generating the electrochemical potential required for ATP synthesis.

Database Links

KEGG: rfe:RF_1010

STRING: 315456.RF_1010

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the role of Ubiquinol-cytochrome c reductase Iron-Sulfur Subunit in Rickettsia felis?

The Ubiquinol-cytochrome c reductase Iron-Sulfur Subunit (petA) is a critical component of the respiratory chain in Rickettsia felis. It functions as part of Complex III (cytochrome bc1 complex) in the electron transport chain, mediating electron transfer from ubiquinol to cytochrome c. This process is essential for energy production in this intracellular pathogen, which has limited metabolic capabilities due to its obligate intracellular lifestyle . As a component of the respiratory chain, the iron-sulfur protein works alongside cytochrome C and cytochrome A to facilitate oxidative phosphorylation, which is crucial for the pathogen's survival within host cells .

How does the petA protein contribute to Rickettsia felis pathogenesis?

The petA protein is essential for energy metabolism in R. felis, indirectly contributing to its pathogenesis by enabling the bacterium to survive and replicate within host cells. While not a virulence factor in the traditional sense, disruption of this protein would likely impair the pathogen's energy production, hindering its ability to cause infection. R. felis causes cat-flea typhus (also known as flea-borne spotted fever) in humans, which presents with symptoms including fever, headache, rash, and other manifestations that can be confused with other infections like dengue fever . The essential nature of respiratory chain components like petA makes them potential drug targets, as inhibiting them could prevent bacterial growth without directly affecting human proteins .

What is the genomic context of the petA gene in Rickettsia felis?

The petA gene is part of the core genome of Rickettsia felis, being essential for cellular respiration. Based on comparative genomics studies of rickettsial species, genes involved in essential metabolic functions like energy production tend to be highly conserved, though specific sequence variations may exist between strains. The complete genome of R. felis has been sequenced and annotated, revealing a relatively small genome characteristic of obligate intracellular pathogens. Like other bacteria in the respiratory chain, the petA gene is likely organized within an operon structure containing other components of the cytochrome bc1 complex . Genome analysis has revealed that R. felis demonstrates significant genetic variation, with studies showing only about 23.04% core genes across the species, indicating potential strain-specific differences in metabolic proteins .

What are the optimal expression systems for producing recombinant Rickettsia felis petA protein?

  • Codon optimization for the expression host

  • Fusion with solubility-enhancing tags (e.g., MBP, SUMO, or TRX)

  • Expression at lower temperatures (16-25°C) to facilitate proper folding

  • Use of specialized E. coli strains designed for membrane/iron-sulfur proteins

For more authentic protein folding and post-translational modifications, insect cell expression systems (Sf9 or Sf21 cells with baculovirus vectors) may yield better results, especially since R. felis naturally infects arthropods . Alternatively, cell-free expression systems could be employed when toxicity is an issue. Success rates must be experimentally determined through pilot expression studies with various constructs and conditions.

What purification strategies are most effective for recombinant petA protein?

Purification of recombinant R. felis petA protein requires specialized approaches due to its membrane association and iron-sulfur cluster. A multi-step purification protocol would typically include:

  • Initial extraction: Membrane solubilization using mild detergents (n-dodecyl-β-D-maltoside or digitonin)

  • Affinity chromatography: Utilizing engineered tags (His6, Strep-tag II)

  • Ion-exchange chromatography: To separate based on surface charge properties

  • Size-exclusion chromatography: Final polishing step

Purification StepReagentsConditionsExpected Results
Membrane extraction1% DDM in phosphate buffer with protease inhibitors4°C, gentle agitation, 1-2 hoursSolubilized membrane proteins
IMAC (His-tag)Ni-NTA resin, imidazole gradient (20-300 mM)pH 7.5, 4°C70-80% purity
Anion exchangeQ Sepharose, NaCl gradient (0-500 mM)pH 8.085-90% purity
Size exclusionSuperdex 200, buffer with 0.05% DDMFlow rate 0.5 ml/min>95% purity

Throughout purification, maintaining the integrity of the iron-sulfur cluster requires anaerobic conditions or the presence of reducing agents. Spectroscopic analysis (UV-visible) should be performed at each step to monitor the characteristic absorbance of the iron-sulfur cluster .

How can researchers confirm the proper folding and activity of recombinant petA protein?

Verification of proper folding and functional activity of recombinant R. felis petA protein requires multiple complementary approaches:

  • Spectroscopic analysis: UV-visible spectroscopy to detect characteristic absorbance patterns of iron-sulfur clusters (peaks at approximately 320, 420, and 550 nm)

  • Circular dichroism (CD): To assess secondary structure elements

  • Electron paramagnetic resonance (EPR): To confirm the presence and state of iron-sulfur clusters

  • Functional assays:

    • Ubiquinol-cytochrome c reductase activity measured by spectrophotometric monitoring of cytochrome c reduction

    • Rate of electron transfer from ubiquinol to cytochrome c using artificial electron donors/acceptors

The enzymatic activity should be determined under various conditions (pH, temperature, ionic strength) to establish optimal parameters. Comparison with recombinant equivalents from other species can provide valuable benchmarks. Additionally, thermal shift assays can assess protein stability, which is critical for downstream applications .

How can recombinant petA be used to identify potential inhibitors against Rickettsia felis?

Recombinant petA protein provides an excellent platform for high-throughput screening of potential R. felis inhibitors. A comprehensive drug discovery workflow would include:

  • Primary screening: Enzymatic assays measuring ubiquinol-cytochrome c reductase activity in the presence of compound libraries

  • Secondary validation: Dose-response studies with hit compounds

  • Binding studies: Surface plasmon resonance or isothermal titration calorimetry to characterize binding kinetics

  • Structural studies: Co-crystallization with inhibitors to determine binding modes

  • In silico approaches: Similar to methods used for succinate dehydrogenase inhibitors, where researchers screened approximately 18,000 ZINC compounds to identify promising inhibitors

The ubiquinol-cytochrome c reductase complex represents an attractive drug target due to its essential role in energy metabolism. Similar to the succinate dehydrogenase approach detailed in the research, targeting the electron transport chain components could lead to novel therapeutics against R. felis. After identifying potential inhibitors, candidates should be evaluated for ADMET properties to prioritize compounds for further development .

What structural features of the petA protein contribute to its function in the electron transport chain?

The petA protein contains several key structural features that enable its electron transfer function:

  • Iron-sulfur cluster: Typically a [2Fe-2S] Rieske-type cluster coordinated by two cysteine and two histidine residues

  • Transmembrane domain: Anchors the protein to the bacterial inner membrane

  • Highly conserved residues: Form the electron transfer pathway between ubiquinol and the iron-sulfur cluster

The protein likely exists as part of a larger complex (cytochrome bc1) that includes cytochrome b and cytochrome c1. The spatial arrangement of these components creates an electron transfer pathway that couples electron movement to proton translocation across the membrane. This generates a proton motive force utilized for ATP synthesis.

Comparative analysis with other bacterial iron-sulfur proteins would reveal conserved features essential for function versus species-specific adaptations. High-resolution structural studies (X-ray crystallography or cryo-EM) would provide detailed insights into the electron transfer mechanisms specific to R. felis .

How does the petA protein interact with other components of the Rickettsia felis respiratory chain?

The petA protein (iron-sulfur subunit) functions within the cytochrome bc1 complex (Complex III) of the respiratory chain through specific protein-protein interactions:

  • Interaction with cytochrome b: Forms the core of the bc1 complex, creating a ubiquinol binding pocket

  • Interaction with cytochrome c1: Facilitates electron transfer from the iron-sulfur cluster to cytochrome c

  • Interaction with ubiquinol/ubiquinone: Substrate binding and electron extraction

  • Interaction with cytochrome c: Terminal electron acceptor from the bc1 complex

These interactions can be studied through:

  • Pull-down assays using tagged recombinant proteins

  • Blue native PAGE to isolate intact respiratory complexes

  • Cross-linking mass spectrometry to map interaction interfaces

  • Yeast two-hybrid or bacterial two-hybrid systems for protein-protein interaction mapping

Understanding these interactions provides insights into the assembly and function of the respiratory chain in R. felis, potentially revealing species-specific features that could be exploited for therapeutic intervention. Similar approaches have been successfully employed to study respiratory chain components in other bacterial species, contributing to our understanding of bacterial bioenergetics .

What are the common challenges in maintaining iron-sulfur cluster integrity during recombinant protein expression?

Iron-sulfur clusters are notoriously sensitive to oxidative damage, creating significant challenges during recombinant protein expression and purification. Researchers should address these issues through:

  • Co-expression with iron-sulfur cluster assembly proteins: Include genes for IscS, IscU, and other assembly machinery

  • Supplementation with iron and sulfur sources: Add ferrous ammonium sulfate and L-cysteine to the growth medium

  • Anaerobic or microaerobic conditions: Grow cultures under reduced oxygen conditions

  • Addition of reducing agents: Include β-mercaptoethanol, DTT, or glutathione in buffers

  • Temperature consideration: Lower expression temperatures (16-20°C) to allow proper assembly

A systematic approach involves testing multiple expression conditions while monitoring iron-sulfur cluster incorporation through spectroscopic methods. The integrity of the iron-sulfur cluster can be verified by characteristic absorption peaks in UV-visible spectroscopy. Researchers should expect yield reductions when optimizing for proper folding rather than protein quantity .

How can researchers overcome the challenges of studying membrane-associated proteins like petA?

Membrane-associated proteins like petA present unique challenges for expression, purification, and structural studies. Effective strategies include:

  • Expression optimization:

    • Testing different detergents for solubilization (DDM, LMNG, digitonin)

    • Using specialized E. coli strains (C41, C43) designed for membrane protein expression

    • Creating fusion constructs with solubility-enhancing partners

  • Purification considerations:

    • Maintaining detergent above critical micelle concentration throughout purification

    • Using lipid nanodiscs or amphipols for detergent-free environments

    • Reconstitution into liposomes for functional studies

  • Structural studies:

    • Cryo-EM for structure determination in a near-native environment

    • Lipid cubic phase crystallization for X-ray diffraction studies

    • Solid-state NMR for structural and dynamic information

Success often requires iterative optimization of construct design, expression conditions, and purification protocols specific to the protein of interest. The challenges encountered with petA would be similar to those faced during studies of other membrane-associated respiratory chain components .

How can researchers distinguish between native and artifactual properties of recombinant petA?

Distinguishing between native properties and artifacts introduced during recombinant expression is critical for reliable research outcomes. Multiple validation approaches should be employed:

  • Comparative analysis:

    • Compare recombinant protein properties with native protein (if extractable)

    • Compare with homologous proteins from related organisms

  • Functional validation:

    • Enzymatic activity measurements under physiologically relevant conditions

    • Electron transfer rates comparable to native systems

  • Structural integrity assessment:

    • Spectroscopic confirmation of iron-sulfur cluster incorporation

    • Proper oligomeric state verification through size-exclusion chromatography

  • Complementation studies:

    • Ability of the recombinant protein to restore function in knockout systems

  • Mass spectrometry analysis:

    • Verification of post-translational modifications

    • Complete sequence coverage to confirm protein integrity

When discrepancies arise, researchers should systematically modify expression and purification conditions to minimize artifacts. Documentation of all experimental conditions and observed variations is essential for reproducibility and accurate interpretation of results .

How might recombinant petA contribute to vaccine development against Rickettsia felis infections?

While petA is not an outer membrane protein like OmpA (which has been investigated as a potential diagnostic tool) , recombinant petA could still contribute to vaccine development strategies through several approaches:

  • Subunit vaccine component: Though primarily internal, peptide fragments of petA could be presented on MHC molecules and recognized by T cells

  • Carrier protein platform: Engineering petA to display antigenic determinants from surface-exposed R. felis proteins

  • Attenuated vaccine development: Knowledge of essential proteins like petA could guide rational attenuation strategies through controlled expression systems

This research would require:

  • Immunogenicity studies in animal models

  • T-cell epitope mapping within the petA sequence

  • Evaluation of protective immunity against challenge

  • Comparison with other R. felis antigens for optimal vaccine formulation

The value of targeting metabolic proteins like petA for vaccines must be weighed against more traditional surface antigen approaches. Integration with established vaccine technologies, such as mRNA or viral vector platforms, could enhance effectiveness .

What is the potential for using petA sequence variations in molecular epidemiology studies of Rickettsia felis?

Given the genetic variation observed in R. felis strains (with only 23.04% core genes across the species) , petA sequence analysis could provide valuable insights for molecular epidemiology:

  • Strain typing and classification: Sequence variations in petA could serve as molecular markers for tracking transmission patterns

  • Geographical distribution mapping: Different variants may predominate in specific regions

  • Host adaptation signatures: Mutations may reflect adaptation to different arthropod vectors (fleas, ticks, mosquitoes)

  • Evolutionary dynamics: Phylogenetic analysis of petA sequences could reveal evolutionary relationships between isolates

Research methodology would include:

  • Targeted sequencing of petA from clinical and environmental isolates

  • Whole-genome sequencing to contextualize petA variations

  • Bioinformatic analysis to correlate mutations with geographical or host origins

  • Functional studies to determine if variations affect protein activity

This approach could complement existing typing methods and contribute to understanding the expanding geographical distribution and host range of R. felis .

How can structural studies of petA inform the development of specific diagnostic tools for Rickettsia felis infections?

Current diagnosis of R. felis infections is challenging due to cross-reactivity with other rickettsial pathogens . Detailed structural studies of petA could reveal unique epitopes or functional signatures that could be exploited for specific diagnostic applications:

  • Unique epitope identification: Structural analysis could identify regions that are specific to R. felis petA

  • Development of specific antibodies: Monoclonal antibodies against unique petA regions could be developed

  • Aptamer-based detection: Structural information could guide the development of specific aptamers

  • Activity-based assays: If unique functional properties are identified, enzymatic activity could serve as a diagnostic marker

Methodological approaches would include:

  • High-resolution structural determination (X-ray crystallography, cryo-EM)

  • Epitope mapping through hydrogen-deuterium exchange mass spectrometry

  • Computational prediction of antigenic regions unique to R. felis

  • Validation with clinical samples from confirmed cases

While petA is not an ideal diagnostic target compared to surface proteins like OmpA , structural insights could still contribute to the development of more specific diagnostic tools, addressing the current challenge of distinguishing R. felis infections from other febrile illnesses like dengue fever .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.