Recombinant Rickettsia felis Uncharacterized protein RF_0090 (RF_0090)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Characteristics

Recombinant RF_0090 is produced in Escherichia coli with an N-terminal His-tag for purification. Key specifications include:

PropertyDetails
Source SpeciesRickettsia felis
Expression HostE. coli
Protein LengthFull-length mature protein (25–672 amino acids)
Molecular Weight~75 kDa (calculated based on sequence)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -20°C/-80°C
ReconstitutionRecommended in sterile water with 5–50% glycerol for long-term stability

The amino acid sequence includes conserved domains associated with bacterial secretion systems, such as hydrophobic regions typical of T4SS components .

Functional Role in Rickettsia felis Biology

RF_0090 is part of the virB6 operon within the T4SS gene cluster, which facilitates:

  • Conjugative DNA transfer: Shares homology with Agrobacterium tumefaciens VirB6, enabling plasmid exchange between bacteria .

  • Effector translocation: Delivers virulence factors into host cells to modulate intracellular survival .

  • Genomic plasticity: Associated with repetitive transposase elements, contributing to chromosomal rearrangements in R. felis .

Key Genomic Context:

  • Co-located with virB2, virB3, virB4, and other T4SS genes .

  • Linked to plasmid maintenance and antibiotic resistance mechanisms .

Pathogenicity Studies

RF_0090 is used to investigate:

  • T4SS function: Mechanistic studies on effector protein translocation .

  • Host-pathogen interactions: Role in immune evasion and intracellular survival .

Diagnostic Development

  • Antigenic potential: Evaluated for serological assays to detect R. felis infections .

  • Western blot validation: High purity (>90%) ensures reliability in antibody detection .

Comparative Genomics and Evolutionary Insights

Plasmid Association:

  • RF_0090-containing T4SS is conserved across Rickettsia species lacking plasmids, suggesting ancestral acquisition .

  • Co-existence of two plasmid forms (pRF and pRFδ) in R. felis correlates with genomic adaptability .

Phylogenetic Analysis:

  • Clustered within the spotted fever group (SFG) rickettsiae, distinct from typhus group species .

  • Shares 100% sequence identity in gltA, ompB, and 17-kDa antigen genes with clinical isolates .

Challenges and Future Directions

  • Functional annotation: RF_0090 remains "uncharacterized," necessitating knockout studies to elucidate its precise role .

  • Vaccine candidacy: Preclinical trials required to assess immunogenicity .

References

  1. Recombinant RF_0090 product sheet (Creative BioMart) .

  2. T4SS homology in R. felis (PLoS Biology, 2005) .

  3. Clinical detection methods (Frontiers in Cellular and Infection Microbiology, 2022) .

  4. Plasmid variability studies (PLoS One, 2008) .

  5. Genomic plasticity and conjugative transfer (PMC, 2005) .

  6. Epidemiology of flea-borne rickettsiosis (PMC, 2016) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
RF_0090; Uncharacterized protein RF_0090
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-672
Protein Length
Full Length of Mature Protein
Species
Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)
Target Names
RF_0090
Target Protein Sequence
GFGESCSSLPTTSDGYLETDTAYGYIIRNIDMKDPRGNCNSAASSITFCFKNIEGSSSPC TIYNLNEGDSKKISDLSTDNNPDLGANPVLKDIVLTVKKWDNDLCLVMPTSRGPMPVACK SLSATPTPTPPDDENCNIGKSCYTGANYSQSLINFSGLAVQCLSETLNKVFFAGNSCSSQ DQNSRITNLAAFSTFQGYLKRIIGAALILYTMFFAFNMALNKEYASTEKIALFVIKFLLV AYFSIGLGPLDFSGGQPTKENGMLKYGLPLLTGAAPDFAQMIFNAAGSRGLCQFDNSKYK DGYKFYGLWDAIDCRIGYYLGLDLLYNIDKNGVLGNSIGNGPGGNNTPIPNFDPDGKKDR PKDLSKAGALRFFAVMFGFFMAGNVIILAAGLVFSVIFLSILLYFITHYLVCMITIYVMT YISPIFIPMALFTRTKAYFDGWLKVCISCALQPAVVAGFIALLITMYDSAIFKNCEFLRY DYEKGDIRFSTFELRLPNGGADKCQESFGYKMLQYYAGEGWEEHLLILFPIKSIVKDVVS ILAELLCVLVFSVIFYYFSKSIGRFASDLTNGPNMDAVTASPTKIVDLVKKGAAFLKDAA MASQGKPSVGDKPDVGGKRKEGEQQGGDSESGAGGGLADLASGSGGGK
Uniprot No.

Target Background

Database Links

KEGG: rfe:RF_0090

STRING: 315456.RF_0090

Protein Families
TrbL/VirB6 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the basic structural characteristics of Recombinant RF_0090 protein?

The Recombinant Full Length Rickettsia felis Uncharacterized protein RF_0090 is expressed with an N-terminal His tag, spanning amino acids 25-672 of the mature protein. It is derived from Rickettsia felis and expressed in E. coli expression systems. The protein consists of 648 amino acids with the complete sequence: GFGESCSSLPTTSDGYLETDTAYGYIIRNIDMKDPRGNCNSAASSITFCFKNIEGSSSPCTIYNLNEGDSKKISDLSTDNNPDLGANPVLKDIVLTVKKWDNDLCLVMPTSRGPMPVACKSLSATPTPTPPDDENCNIGKSCYTGANYSQSLINFSGLAVQCLSETLNKVFFAGNSCSSQDQNSRITNLAAFSTFQGYLKRIIGAALILYTMFFAFNMALNKEYASTEKIALFVIKFLLVAYFSIGLGPLDFSGGQPTKENGMLKYGLPLLTGAAPDFAQMIFNAAGSRGLCQFDNSKYRDGYKFYGLWDAIDCRIGYYLGLDLLYNIDKNGVLGNSIGNGPGGNNTPIPNFDPDGKKDRPKDLSKAGALRFFAVMFGFFMAGNVIILAAGLVFSVIFLSILLYFITHYLVCMITIYVMTYISPIFIPMALFTRTRAYFDGWLKVCISCALQPAVVAGFIALLITMYDSAIFKNCEFLRYDYEKGDIRFSTFELRLPNGGADKCQESFGYKMLQYYAGEGWEEHLLILFPIKSIVKDVVSILAELLCVLVFSVIFYYFSKSIGRFASDLTNGPNMDAVTASPTKIVDLVKKGAAFLKDAAMASQGKPSVGDKPDVGGKRKEGEQQGGDSESGAGGGLADLASGSGGGK .

How should the lyophilized RF_0090 protein be properly reconstituted for research use?

For optimal reconstitution of the lyophilized RF_0090 protein, researchers should first briefly centrifuge the vial to ensure all content is at the bottom. The protein should be reconstituted in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. For long-term storage, adding glycerol to a final concentration of 5-50% (with 50% being standard) is recommended before aliquoting and storing at -20°C/-80°C. This approach minimizes protein degradation through freeze-thaw cycles and maintains protein stability and activity for extended research applications .

What experimental considerations should be taken when working with purified RF_0090 protein?

When working with purified RF_0090 protein, researchers should note that repeated freeze-thaw cycles significantly reduce protein activity and should be avoided. Working aliquots can be stored at 4°C for up to one week. The protein is stored in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which should be considered when designing downstream applications to avoid buffer incompatibilities. The protein exhibits greater than 90% purity as determined by SDS-PAGE, making it suitable for most research applications including antibody production, protein-protein interaction studies, and functional assays .

How can single-case experimental designs be applied to study RF_0090 protein function?

Single-case experimental designs (SCEDs) represent valuable approaches for studying the effects of RF_0090 protein in experimental settings. These designs focus on demonstrating experimental control of relationships between treatments and outcomes. For RF_0090 studies, a reversal design (A1B1A2B2) could be implemented, where A phases represent control conditions without the protein and B phases represent experimental conditions with the protein. This would allow for three replications of treatment effects (A1 versus B1, B1 versus A2, A2 versus B2) to demonstrate experimental control. Such designs help establish causality in protein function studies where large sample sizes might not be feasible or appropriate .

What are appropriate controls when studying the functions of RF_0090 protein?

When studying RF_0090 protein functions, multiple control types should be implemented. A negative control should include the same buffer components without the protein. For tag-specific effects, a control protein with the same His-tag but unrelated to Rickettsia would account for potential tag interference. Since RF_0090 is expressed in E. coli, a control using an E. coli extract processed identically but from cells not expressing the protein would control for potential bacterial contaminants. Additionally, when studying protein-protein interactions, blocking experiments using anti-RF_0090 antibodies can confirm specificity. These controls ensure that observed effects are specifically attributable to RF_0090 rather than experimental artifacts .

How does RF_0090 relate to the plasmid biology of Rickettsia felis?

The RF_0090 protein should be evaluated in the context of Rickettsia felis' unique plasmid biology. R. felis possesses two plasmids, pRF (62,829 bp) and pRFδ (39,263 bp), which are specific to this species and not detected in other rickettsial species. The pRF plasmid contains 68 ORFs, 53 of which (77.9%) have homologs in public databases, while 64.7% are associated with functional attributes. The plasmids appear to contain genes involved in conjugative functions, suggesting potential horizontal gene transfer capabilities. Researchers investigating RF_0090 should consider whether this protein interacts with plasmid-encoded functions, particularly given R. felis' unique ability among rickettsiae to maintain plasmids, which may contribute to its distinctive pathogenic properties and host range .

What methodological approaches can be used to study the evolutionary conservation of RF_0090 across Rickettsia species?

To study the evolutionary conservation of RF_0090 across Rickettsia species, researchers should employ a multi-faceted comparative genomics approach. Begin with sequence alignment tools like BLAST, MUSCLE, or Clustal Omega to identify homologs across available Rickettsia genomes. Follow with phylogenetic analysis using maximum likelihood or Bayesian methods to reconstruct evolutionary relationships. Domain architecture analysis using tools like PFAM or InterPro can identify conserved functional domains. Positive selection analysis using PAML or HyPhy can detect regions under selective pressure. Synteny analysis should examine conservation of genomic context around RF_0090. Finally, heterologous expression of homologs can test functional conservation. This integrated approach provides insights into the protein's evolutionary history and functional importance across the Rickettsia genus .

What experimental methods are most appropriate for determining the subcellular localization of RF_0090?

For determining the subcellular localization of RF_0090, researchers should employ a complementary set of techniques. Immunofluorescence microscopy using anti-His or specific anti-RF_0090 antibodies can visualize the protein within cells. This approach proved valuable for analyzing RickA protein in R. felis, revealing its association with actin filaments. Subcellular fractionation followed by Western blotting can biochemically separate membrane, cytosolic, and nuclear fractions to determine the protein's compartmentalization. For higher resolution, immunoelectron microscopy can precisely localize the protein at the ultrastructural level, which was successfully used to identify pili structures in R. felis. Finally, fluorescent protein fusions expressed in model systems can provide live-cell visualization of localization patterns and dynamics .

How can researchers determine if RF_0090 interacts with host cell components during infection?

To investigate RF_0090 interactions with host cell components during infection, researchers should implement a multi-method approach. Co-immunoprecipitation using anti-His tag or specific antibodies against RF_0090 can pull down host protein complexes for identification by mass spectrometry. Proximity labeling techniques like BioID or APEX can identify proteins in close proximity to RF_0090 within living cells. Yeast two-hybrid screening can identify direct protein-protein interactions when using RF_0090 as bait. For validation, FRET or BiFC microscopy can confirm interactions in living cells. Functional assays such as studying the effects of RF_0090 on host cell actin dynamics (similar to RickA) can connect interactions to biological outcomes. This integrated approach provides complementary data to reliably identify and characterize host-pathogen protein interactions .

How does RF_0090 potentially contribute to R. felis virulence mechanisms?

The contribution of RF_0090 to R. felis virulence requires investigation through multiple experimental approaches. Considering R. felis' known pathogenic mechanisms, RF_0090 might be involved in host cell invasion, similar to how R. felis uses actin-based motility facilitated by the RickA protein. Researchers should examine if RF_0090 participates in pili formation, as electron microscopy has revealed two forms of pili on R. felis that establish either direct bacterial contact (conjugation) or hair-like projections for cell attachment. Additionally, RF_0090 may contribute to hemolytic activity, as R. felis possesses patatin-like proteins that confer hemolytic capacity inhibited by dithiothreitol. Examining RF_0090's role in these processes through gene knockout or protein inhibition studies could elucidate its virulence contributions .

What experimental methods can be used to determine if RF_0090 affects host cell cytoskeleton during infection?

To investigate RF_0090's potential effects on host cell cytoskeleton, researchers should implement a comprehensive experimental workflow. Immunofluorescence microscopy co-staining for RF_0090 and cytoskeletal components (actin, microtubules, intermediate filaments) can reveal colocalization patterns. Live-cell imaging with fluorescently tagged cytoskeletal proteins in cells expressing RF_0090 can capture dynamic reorganization. Biochemical assays measuring cytoskeletal polymerization rates in the presence of purified RF_0090 can determine direct effects. Electron microscopy, which successfully revealed R. felis pili structures, can provide ultrastructural evidence of cytoskeletal interactions. Genetic approaches using RF_0090 knockout strains compared to wild-type can establish causality. This approach is particularly relevant given that R. felis has demonstrated the ability to manipulate actin cytoskeleton for cell-to-cell dissemination .

What computational approaches can predict functional domains within the RF_0090 protein sequence?

Predicting functional domains within RF_0090 requires a systematic computational approach. Begin with transmembrane domain prediction using tools like TMHMM or Phobius, as the amino acid sequence suggests potential membrane association (e.g., "MFFAFNMALNKEY..." regions). Follow with signal peptide prediction using SignalP to identify potential secretion signals. For domain architecture, use InterPro, PFAM, and CDD to identify conserved domains. Employ protein structure prediction using AlphaFold2 or RoseTTAFold to generate 3D models that may reveal structural homology not evident in sequence comparisons. Use disorder prediction (PONDR, IUPred) to identify flexible regions. Finally, perform protein threading against known structures using I-TASSER or Phyre2. This pipeline maximizes the likelihood of identifying functional domains within this uncharacterized protein .

How can researchers design site-directed mutagenesis experiments to identify critical functional residues in RF_0090?

Designing effective site-directed mutagenesis experiments for RF_0090 requires a strategic approach to identify critical functional residues. First, conduct multiple sequence alignment across Rickettsia species to identify conserved residues, which often indicate functional importance. Use computational predictions to identify potential active sites, binding regions, or structural motifs. Consider the hydrophobicity pattern within the sequence (e.g., "LLVAYFSIGLGPLDF" region) that might indicate membrane-interacting domains. Select conserved charged residues (D, E, K, R) for initial mutagenesis as they often participate in catalytic functions. For each identified region, design alanine scanning mutations to systematically replace amino acids with alanine, which neutralizes side chain functions while maintaining structural stability. Include control mutations in non-conserved regions to validate specificity. Express mutant proteins and assess changes in activity, localization, or interaction profiles compared to wild-type RF_0090 .

What mass spectrometry approaches are most suitable for characterizing post-translational modifications of RF_0090?

Characterizing post-translational modifications (PTMs) of RF_0090 requires specialized mass spectrometry approaches. Begin with bottom-up proteomics, where purified RF_0090 is digested with multiple proteases (trypsin, chymotrypsin, and Glu-C) to generate overlapping peptides ensuring comprehensive sequence coverage. Enrichment techniques should be employed for specific PTMs: TiO2 chromatography for phosphorylation, lectin affinity for glycosylation, and antibody-based enrichment for acetylation or methylation. High-resolution mass spectrometry using Orbitrap or Q-TOF instruments with electron transfer dissociation (ETD) and higher-energy collisional dissociation (HCD) fragmentation provides complementary data for confident PTM assignment. For intact protein analysis, top-down proteomics using native MS can determine the stoichiometry of modifications. Targeted parallel reaction monitoring (PRM) can quantify specific modified peptides across experimental conditions. This comprehensive approach accounts for the complex nature of bacterial protein modifications that may regulate RF_0090 function .

What are the optimal conditions for crystallization trials of purified RF_0090 protein?

Optimizing crystallization conditions for RF_0090 requires a systematic approach addressing its specific characteristics. Based on the amino acid sequence and expression system, researchers should first perform a buffer optimization screen using differential scanning fluorimetry to identify conditions that maximize thermal stability. Given RF_0090's size (648 amino acids) and potential flexibility, limited proteolysis followed by mass spectrometry can identify stable domains for crystallization. Initial screening should employ sparse matrix screens at multiple protein concentrations (5-15 mg/mL) in 96-well sitting drop vapor diffusion plates at both 4°C and 20°C. Surface entropy reduction, where clusters of flexible, charged residues are mutated to alanines, may improve crystal packing. Addition of ligands or binding partners identified through functional studies can stabilize specific conformations. For membrane-associated regions suggested by the sequence, inclusion of detergents or lipidic cubic phase crystallization may be necessary. Microseeding from initial crystalline material can improve crystal quality in optimization rounds .

What alternative expression systems should be considered for producing RF_0090 when E. coli-based systems yield insoluble protein?

When E. coli expression systems yield insoluble RF_0090, researchers should consider several alternative expression platforms. Insect cell systems using baculovirus vectors (Sf9, Sf21, or High Five cells) often improve folding of complex bacterial proteins through enhanced chaperone assistance and eukaryotic-like post-translational processing. Cell-free expression systems allow direct manipulation of the translation environment, enabling addition of detergents or lipids for membrane-associated regions in RF_0090. Yeast systems (Pichia pastoris or Saccharomyces cerevisiae) combine high expression with proper folding machinery. For challenging proteins, mammalian expression in HEK293 or CHO cells provides the most sophisticated folding machinery. If solubility remains problematic, consider fusion tags beyond His-tag, such as MBP, SUMO, or Trx, which significantly enhance solubility. Codon optimization for the selected expression system is essential, as is expression at reduced temperatures (16-20°C) to slow folding and prevent aggregation. This systematic approach maximizes the chances of obtaining soluble, functional RF_0090 protein .

How can researchers design truncation constructs of RF_0090 to identify functional domains experimentally?

Designing effective truncation constructs for RF_0090 requires both computational prediction and systematic experimental strategies. Begin with bioinformatic analysis using domain prediction tools (InterPro, SMART) and secondary structure prediction (PSIPRED) to identify potential domain boundaries. Hydrophobicity analysis can identify transmembrane or membrane-associated regions that should remain intact in constructs. Design an overlapping series of N- and C-terminal truncations that progressively remove 50-100 amino acids while maintaining predicted domain boundaries. Create internal fragments corresponding to predicted domains with appropriate linkers. Express each construct with the same tag system (His-tag) used successfully for the full-length protein, and assess expression, solubility, and stability using small-scale purification followed by SDS-PAGE and thermal shift assays. For functional characterization, develop domain-specific activity assays based on predicted functions. This systematic approach enables mapping of functional regions within the 648-amino acid RF_0090 protein while minimizing the risk of disrupting critical structural elements .

How can RF_0090-specific antibodies be developed for diagnostic applications in R. felis infections?

Developing RF_0090-specific antibodies for diagnostic applications requires a strategic immunization and screening approach. Begin by identifying antigenic epitopes using computational prediction tools like BepiPred and immunogenicity analysis of the protein sequence. Design multiple peptide antigens from highly antigenic regions and synthesize these alongside the recombinant full-length protein for immunization. Implement a parallel immunization strategy using both rabbits and mice to generate polyclonal and monoclonal antibodies, respectively. During screening, perform rigorous cross-reactivity testing against protein extracts from related Rickettsia species to ensure specificity, as R. felis has unique plasmids not found in other rickettsial species. For diagnostic validation, test antibodies against clinical samples from confirmed R. felis infection cases and negative controls. Optimize antibody application in multiple diagnostic formats including ELISA, immunofluorescence assays, and lateral flow devices. This comprehensive approach ensures development of highly specific antibodies suitable for reliable R. felis diagnostics .

What experimental approaches can determine if RF_0090 is a potential therapeutic target for R. felis infections?

Determining RF_0090's potential as a therapeutic target requires a systematic experimental pipeline. First, establish essentiality through conditional gene knockdown or CRISPR interference in R. felis, which is challenging but feasible with appropriate shuttle vectors. Perform in vitro inhibition assays using small molecule libraries screened against purified RF_0090 to identify potential inhibitors. Structural studies using X-ray crystallography or cryo-EM can reveal druggable pockets. Cell-based assays measuring R. felis growth and infection capacity in the presence of identified inhibitors can validate target engagement in a biological context. Animal infection models can then assess inhibitor efficacy in vivo. For target validation, complement gene knockouts with plasmid-expressed wild-type RF_0090 to confirm phenotype rescue. This approach is particularly relevant given that R. felis has demonstrated β-lactam inhibition (57% inhibition following 2h incubation with amoxicillin), suggesting potential antibiotic targets within its proteome .

What methodological approaches can compare RF_0090 functional properties across different Rickettsia species?

Comparing RF_0090 functional properties across Rickettsia species requires a multi-platform approach. Begin with homology searching using BLAST and HMM profiles to identify RF_0090 homologs in other Rickettsia genomes. For functional comparison, heterologous expression of identified homologs using the established E. coli system with His-tag purification allows direct biochemical comparisons. Develop standardized functional assays based on predicted activities (e.g., protein-protein interactions, enzymatic activity) and compare activities under identical conditions. For in vivo functional comparison, create chimeric proteins by swapping domains between RF_0090 and homologs, then assess their activity in relevant infection models. Structural studies using X-ray crystallography or hydrogen-deuterium exchange mass spectrometry can identify conformational differences that explain functional divergence. This systematic comparative approach can reveal species-specific adaptations and conserved functions, particularly important since RF_0090 may relate to R. felis-specific biology mediated by its unique plasmids not found in other rickettsial species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.