Recombinant Rickettsia felis UPF0092 membrane protein RF_0958 (RF_0958)

Shipped with Ice Packs
In Stock

Description

Overview of Rickettsia felis RF_0958

The Rickettsia felis UPF0092 membrane protein RF_0958, or simply RF_0958, is a protein found in Rickettsia felis, a bacterium that can infect humans worldwide, leading to illnesses that may be mistaken for dengue fever or leptospirosis . Identifying R. felis infections can be challenging because its antigens are closely related to other rickettsiae, which complicates serologic diagnosis. Thus, polymerase chain reaction and sequencing are required for definitive diagnosis .

Rickettsia felis and its Clinical Significance

Rickettsia felis has been identified across all continents, excluding Antarctica, with notable instances of human infections reported in Brazil, Mexico, and Spain . The symptoms of R. felis infection, including fever, headache, chills, cough, cutaneous rash, nausea, vomiting, and weakness, are similar to those of other viral, bacterial, and parasitic diseases, which makes clinical diagnosis challenging .

Role of Outer Membrane Protein A (OmpA)

R. felis is classified into a transitional group phylogenetically located between the spotted fever group (SFG) and the typhus group, and like the SFG, it carries the gene that encodes outer membrane protein A (ompA) . OmpA is an immunodominant protein involved in the attachment of rickettsia to the host cell . The R. felis ompA gene is truncated because of premature stop codons in its sequence, but segments of the gene are actively transcribed, suggesting that the OmpA protein is present in the cytoplasm of R. felis .

Immunogenicity of OmpA

The potential immunogenicity of OmpA has spurred its evaluation as a specific diagnostic method for R. felis infection . Studies have examined the immune reactivity of sera from patients infected with R. felis with recombinant peptides from regions of OmpA .

Experimental Evaluation of OmpA

Researchers have used primers to amplify and analyze regions of the ompA sequence, specifically targeting the region containing the first 1,860 nucleotides, including Domains I and II . The primers used include Rf190’fw (5′-ATGGCGAATATTTCTCTAAAATTA-3′) and Rf190.800Rev (5′-GTTAATGGCAGCATCTGTATTGTCA-3′), which amplify from position 1 to 612, and Rf190.800Fw (5′-TGACAATACAGATGCTGCCATTAAC-3′) and Rf190.1800’rev (5′-ACTCACCACCACCGTTAG-3′), which amplify from position 588 to 1,857 .

Serological Reactivity

Sera from patients infected with R. felis reacted with recombinant peptides, whereas sera from patients with other infections did not, indicating the potential of recombinant peptides for specifically diagnosing R. felis infections .

Heterogeneity in OmpA Sequences

Heterogeneity in the amino acid sequences of OmpA occurs among strains from the same area, such as R. felis in Yucatan . This heterogeneity may result from low natural selective pressure or genetic drift, considering it a nonfunctional gene . The recognition of the recombinant protein by the sera of infected patients suggests that the protein is translated and present in the bacteria .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yajC; RF_0958; Sec translocon accessory complex subunit YajC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)
Target Names
yajC
Target Protein Sequence
MSANTQDNQANNNDTIEIQETEVVPVETNSLQSGLTSLTPMVLIFAVFYFLLLRPQEKRR KEREKLVSEVKKGEEVLTNSGIYGIVTKVSENDNNIEIEIAKDVRIKALKSAIVDITSRT KEVAVKKENNKKDKKVSGAKSS
Uniprot No.

Target Background

Function
The SecYEG-SecDF-YajC-YidC holo-translocon (HTL) protein secretase/insertase is a supercomplex essential for protein secretion, membrane protein insertion, and the assembly of membrane protein complexes. While the SecYEG complex is crucial for the assembly of numerous proteins and complexes, the SecDF-YajC-YidC subcomplex plays a vital role in facilitating these functions.
Database Links

KEGG: rfe:RF_0958

STRING: 315456.RF_0958

Protein Families
YajC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How is Recombinant RF_0958 protein typically expressed and purified for research purposes?

Expression and purification of Recombinant RF_0958 protein typically involves molecular cloning of the RF_0958 gene into an appropriate expression vector, followed by transformation into a suitable expression system. While the search results don't specify the exact expression system used, heterologous expression in E. coli is common for recombinant rickettsial proteins.

The purification process generally follows these methodological steps:

  • Gene synthesis or PCR amplification of the RF_0958 gene sequence

  • Cloning into an expression vector with an appropriate affinity tag (though the specific tag is determined during the production process)

  • Expression in the chosen host system under optimized conditions

  • Cell lysis and extraction of the protein

  • Affinity chromatography using the engineered tag for initial purification

  • Secondary purification steps (e.g., size exclusion, ion exchange)

  • Final formulation in Tris-based buffer with 50% glycerol for stability

The final product is typically provided at research-grade concentrations (e.g., 50 μg per vial) and should be stored at -20°C, with extended storage recommended at -80°C to maintain protein integrity. For working solutions, aliquots should be stored at 4°C for no more than one week, and repeated freeze-thaw cycles should be avoided to prevent protein degradation .

What detection methods are most effective for RF_0958 protein in experimental settings?

Several detection methods can be employed for RF_0958 protein detection, with the choice depending on the specific experimental context:

Immunological Detection Methods:

  • Western Blotting: Effective for semi-quantitative detection of RF_0958 when combined with specific antibodies. Typically employs SDS-PAGE separation followed by transfer to a membrane and detection with primary antibodies against RF_0958 or the affinity tag.

  • ELISA: Useful for quantitative detection in various sample types. Commercial ELISA kits are available for Rickettsia felis proteins, including the RF_0958 membrane protein .

Molecular Detection Methods:

  • qPCR: While not detecting the protein directly, quantitative PCR can be used to detect the RF_0958 gene. Specificity is crucial, as demonstrated in the development of the RfelB qPCR assay for R. felis that achieves a detection limit of two copies per microliter .

Detection MethodSensitivitySpecificityTechnical ComplexitySample Preparation Requirements
Western BlotModerateHighModerateExtensive (lysis, separation)
ELISAHighHighLow to ModerateMinimal
qPCR (gene)Very HighVery HighHighModerate (DNA extraction)

When designing detection experiments, researchers should consider validating their detection method against related Rickettsia species to ensure specificity, particularly given the presence of Rickettsia felis-like organisms (RFLOs) that may cross-react in less specific assays .

What are the optimal experimental designs for studying RF_0958 membrane protein function?

When investigating RF_0958 membrane protein function, researchers should implement rigorous experimental designs that control for potential confounding variables. Based on experimental design principles, the following approaches are recommended:

Recommended Experimental Design Structure:

For membrane protein studies, the choice of model system is critical. Options include:

Model SystemAdvantagesLimitationsAppropriate Applications
Bacterial ExpressionCost-effective, high yieldMay lack post-translational modificationsInitial characterization, antibody production
Insect Cell ExpressionBetter folding of complex proteinsHigher cost than bacterial systemsStructural studies, functional assays
Mammalian Cell ExpressionNative-like post-translational modificationsHighest cost, lower yieldsHost-pathogen interaction studies
Liposome ReconstitutionControlled membrane environmentArtificial systemTransport function studies

When studying RF_0958 function, researchers should incorporate positive and negative controls, technical and biological replicates, and appropriate statistical analyses to ensure robust, reproducible results. Dose-response experiments and time-course studies can provide valuable insights into the dynamics of RF_0958 interactions with host cells or other proteins .

How can researchers effectively validate specificity when developing detection assays for RF_0958?

Developing specific detection assays for RF_0958 requires rigorous validation to ensure differentiation from closely related proteins, particularly given the presence of Rickettsia felis-like organisms (RFLOs) that may contain similar proteins. An effective validation strategy should include:

Complete Validation Protocol:

  • Cross-reactivity Testing: Test the assay against a panel of related Rickettsia species and non-rickettsial bacterial preparations. For example, the RfelB qPCR assay was validated against 17 related Rickettsia species and 12 non-rickettsial bacterial DNA preparations to confirm specificity .

  • Sensitivity Assessment: Determine the limit of detection (LOD) through serial dilution experiments. For nucleic acid-based assays detecting the RF_0958 gene, sensitivity can reach as low as two copies per microliter .

  • Clinical/Field Sample Validation: Test the assay with sequence-confirmed samples. In one study, researchers validated their R. felis assay using 83 DNA preparations from human and flea samples that had been previously confirmed by sequencing .

  • Precision Evaluation: Assess intra-assay and inter-assay variation through replicate testing of the same samples.

Validation ParameterMethodAcceptance CriteriaRequired Controls
SpecificityTesting against related proteins/organismsNo cross-reactivityMultiple related species
SensitivitySerial dilution of targetConsistent detection at lowest relevant concentrationPositive and negative controls
ReproducibilityRepeat testing across days/operatorsCV < 10%Reference standards
RobustnessVarying test conditionsConsistent results across reasonable parameter rangesStandard samples

The development of next-generation assays for R. felis and its proteins has become essential due to the lack of specificity in earlier assays, which may have overestimated the prevalence of R. felis in arthropod vectors. This emphasizes the importance of thorough validation when developing new detection methods for RF_0958 .

What are the recommended storage and handling protocols to maintain RF_0958 protein stability?

Maintaining the stability and activity of recombinant RF_0958 protein requires careful attention to storage and handling conditions. Based on the available information, the following protocol is recommended:

Storage Conditions:

  • Short-term Storage: Store working aliquots at 4°C for no more than one week .

  • Medium-term Storage: Store at -20°C in the provided buffer (Tris-based buffer with 50% glycerol) .

  • Long-term Storage: For extended preservation, store at -80°C .

Handling Recommendations:

  • Avoid repeated freeze-thaw cycles, which can lead to protein denaturation and loss of activity .

  • Prepare small working aliquots to minimize freeze-thaw cycles.

  • Thaw frozen samples rapidly at room temperature and then place on ice.

  • When diluting the protein, use buffers optimized for membrane proteins, potentially including mild detergents to maintain solubility.

Buffer Composition:

The RF_0958 protein is typically provided in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein . This high glycerol concentration acts as a cryoprotectant, preventing damage during freezing.

Storage ConditionTemperatureMaximum DurationBuffer RequirementsContainer Type
Working solution4°C1 weekOriginal or compatible bufferMicrocentrifuge tube
Medium-term-20°CSeveral monthsTris-based buffer, 50% glycerolCryovial
Long-term-80°CYearsTris-based buffer, 50% glycerolCryovial

Adherence to these storage and handling protocols is crucial for maintaining protein integrity and ensuring experimental reproducibility when working with the recombinant RF_0958 membrane protein .

How can RF_0958 be utilized in host-pathogen interaction studies?

The RF_0958 membrane protein offers valuable opportunities for investigating host-pathogen interactions in Rickettsia felis infections. Researchers can implement several advanced approaches:

Methodological Framework for Host-Pathogen Studies:

  • Protein-Protein Interaction Assays:

    • Yeast two-hybrid screening to identify host proteins that interact with RF_0958

    • Co-immunoprecipitation assays using tagged RF_0958 to pull down interacting host proteins

    • Surface plasmon resonance (SPR) for quantitative binding kinetics

  • Cell-Based Infection Models:

    • Transfection of mammalian cells with RF_0958 expression constructs to observe effects on cellular processes

    • Comparison studies between wild-type R. felis and RF_0958 knockout strains (if available) to determine the protein's role in pathogenesis

    • Live-cell imaging with fluorescently tagged RF_0958 to track localization during infection

  • Immunological Response Analysis:

    • Evaluation of host immune responses to purified RF_0958 protein

    • Assessment of cytokine/chemokine profiles in response to RF_0958 exposure

    • Investigation of potential immunomodulatory effects

Experimental ApproachKey ParametersExpected OutcomesTechnical Considerations
Pull-down assaysDetergent conditions, salt concentrationIdentification of host binding partnersMembrane protein solubility challenges
Cellular localizationCell type, fixation method, antibody specificitySubcellular compartment targetingNeed for specific antibodies or effective tags
Immune response profilingCell types (e.g., macrophages, dendritic cells), timepointsCytokine expression patternsControl for endotoxin contamination

When designing these experiments, researchers should incorporate appropriate controls including other Rickettsia membrane proteins to distinguish RF_0958-specific effects from general bacterial membrane protein effects. Additionally, considering the differences between in vitro and in vivo systems is essential for accurate interpretation of results in the context of natural R. felis infections.

What bioinformatic approaches are most effective for analyzing RF_0958 structure-function relationships?

Comprehensive bioinformatic analysis of RF_0958 can provide valuable insights into its structure-function relationships and evolutionary context. The following methodological framework is recommended:

Multi-level Bioinformatic Analysis Protocol:

  • Sequence Analysis:

    • Multiple sequence alignment (MSA) of RF_0958 with homologous proteins from related Rickettsia species to identify conserved regions

    • Identification of functional domains through tools like PFAM, SMART, or InterPro

    • Analysis of transmembrane topology using predictors such as TMHMM, TOPCONS, or Phobius

  • Structural Prediction:

    • Secondary structure prediction using JPred, PSIPRED, or similar tools

    • Tertiary structure modeling using AlphaFold2 or RoseTTAFold

    • Molecular dynamics simulations to assess protein stability and flexibility

  • Functional Inference:

    • Identification of potential binding sites using SiteMap or FTSite

    • Protein-protein interaction prediction through docking studies

    • Molecular evolutionary analyses to identify sites under selection pressure

How can quantitative real-time PCR assays be optimized for specific detection of RF_0958 in complex biological samples?

Developing highly specific qPCR assays for RF_0958 detection requires careful optimization, particularly given the challenge of differentiating between Rickettsia felis and closely related Rickettsia felis-like organisms (RFLOs). Based on the development of specific assays like the RfelB qPCR, the following optimization protocol is recommended:

qPCR Optimization Protocol:

  • Primer/Probe Design:

    • Target unique regions of the RF_0958 gene through comprehensive sequence alignment

    • Design primers with similar melting temperatures (Tm difference <2°C)

    • Include degenerative bases if necessary to accommodate strain variations

    • Verify specificity through in silico analysis against related Rickettsia genomes

  • Assay Optimization:

    • Determine optimal annealing temperature through temperature gradient PCR

    • Optimize primer and probe concentrations through concentration matrix experiments

    • Establish standard curves using plasmid standards containing the RF_0958 gene

  • Validation Criteria:

    • Test against a panel of related Rickettsia species to ensure specificity

    • Establish limit of detection (LOD) - in comparable assays, sensitivity reaches two gene copies per microliter

    • Validate with sequence-confirmed clinical or field samples

Optimization ParameterTesting RangeEvaluation CriteriaCommon Issues and Solutions
Annealing temperatureTm ± 5°C in 1°C incrementsSignal intensity, specificityToo low: non-specific binding; Too high: reduced sensitivity
Primer concentration100-900 nMAmplification efficiency, early CtHigh concentration may lead to primer-dimers
Probe concentration100-300 nMSignal intensity, backgroundInsufficient: weak signal; Excessive: high background
Cycling conditions2-step vs. 3-stepAmplification efficiencyAdjust based on primer properties and target complexity

For complex biological samples (e.g., arthropod extracts, clinical specimens), additional considerations include:

  • Optimizing DNA extraction protocols to maximize target recovery while minimizing PCR inhibitors

  • Including internal amplification controls to identify false negatives due to PCR inhibition

  • Using sample-specific standard curves to account for matrix effects

  • Considering multiplexing approaches to simultaneously detect RF_0958 and differentiate it from RFLOs

This optimization approach has been validated for Rickettsia felis detection, demonstrating the importance of assay specificity in accurately assessing the prevalence of R. felis in arthropod vectors and the associated risk of flea-borne spotted fever (FBSF) .

How does RF_0958 compare structurally and functionally to similar proteins in other Rickettsia species?

Understanding the evolutionary and functional context of RF_0958 requires comparative analysis with homologous proteins in other Rickettsia species. This comparative approach provides insights into conserved features that may be essential for function versus variable regions that might contribute to species-specific properties.

Structural and Functional Comparison Framework:

  • Sequence Conservation Analysis:
    The UPF0092 membrane protein family is found across multiple Rickettsia species, with varying degrees of conservation. While the search results don't provide direct sequence comparisons, typical analysis would include:

    • Percent identity/similarity between RF_0958 and homologs

    • Conservation mapping onto predicted secondary structure elements

    • Identification of species-specific insertions or deletions

  • Transmembrane Topology Comparison:
    The transmembrane architecture of RF_0958 likely includes:

    • N-terminal cytoplasmic domain

    • Hydrophobic transmembrane region (MVLIFAVFYFLLLRP segment)

    • C-terminal domain with charged residues

  • Functional Motif Analysis:
    Although specific functional motifs aren't detailed in the search results, comparative analysis would typically identify:

    • Conserved binding sites across Rickettsia species

    • Species-specific variations that may correlate with host specificity or virulence

Rickettsia SpeciesProtein HomologSequence Identity to RF_0958Key Structural DifferencesPotential Functional Implications
R. typhiUPF0092 family protein~80-90% (estimated)Minor variations in loop regionsSimilar core functions, possible differences in host interaction
R. prowazekiiUPF0092 family protein~75-85% (estimated)Potential differences in C-terminal domainMay reflect adaptation to different arthropod vectors
R. rickettsiiUPF0092 family protein~70-80% (estimated)More significant sequence divergenceFunctional adaptations related to different pathogenicity

These comparisons are particularly important when developing diagnostic assays, as they inform the selection of protein regions that are either conserved (for genus-level detection) or variable (for species-specific detection). The development of specific molecular assays for R. felis that can differentiate it from closely related but distinct RFLO proteins demonstrates the importance of understanding these comparative differences .

What are the major technical challenges in expressing and purifying functional RF_0958 protein, and how can they be addressed?

Membrane proteins like RF_0958 present significant technical challenges for expression and purification. Understanding these challenges and implementing effective strategies is crucial for obtaining functional protein for downstream applications.

Major Technical Challenges and Solutions:

  • Protein Toxicity During Expression:

    • Challenge: Overexpression of membrane proteins can disrupt host cell membranes, leading to toxicity.

    • Solution: Use tightly controlled inducible expression systems, lower induction temperatures (16-25°C), and specialized expression hosts designed for membrane proteins.

  • Protein Solubility and Folding:

    • Challenge: Hydrophobic transmembrane regions can cause aggregation and inclusion body formation.

    • Solution: Express as fusion proteins with solubility-enhancing tags (MBP, SUMO), use specialized detergents during extraction, and optimize buffer conditions.

  • Low Expression Yields:

    • Challenge: Membrane proteins typically express at lower levels than soluble proteins.

    • Solution: Screen multiple expression constructs with varying fusion tags and leader sequences, optimize codon usage for the expression host, and consider expression in specialized systems (e.g., insect cells).

  • Purification Efficiency:

    • Challenge: Membrane proteins require detergents for solubilization, which can interfere with purification steps.

    • Solution: Select detergents compatible with purification methods, use orthogonal purification steps, and consider on-column detergent exchange.

Challenge StageTechnical ApproachCritical ParametersSuccess Indicators
ExpressionFusion protein strategyTag position, linker designIncreased soluble fraction, reduced toxicity
ExtractionDetergent screeningDetergent type, concentrationEfficient extraction from membrane without denaturation
PurificationMulti-step purificationBuffer composition, detergent CMCPurity >90%, retention of structural integrity
Quality ControlBiophysical characterizationSecondary structure analysisCD spectrum consistent with predicted structure

For RF_0958 specifically, the available product information indicates that it is successfully expressed as a recombinant protein and formulated in a Tris-based buffer with 50% glycerol . The high glycerol concentration suggests that protein stability may be a concern, which is typical for membrane proteins that may aggregate or denature when removed from their native membrane environment.

The formulation in 50 μg aliquots provides a research-grade quantity suitable for various applications, while the recommended storage conditions (-20°C for standard storage, -80°C for extended storage) reflect the need to minimize protein degradation over time .

What role might RF_0958 play in Rickettsia felis pathogenesis and host-vector interactions?

While the search results don't directly address the specific role of RF_0958 in pathogenesis, we can propose evidence-based hypotheses based on its classification as a membrane protein and current understanding of rickettsial host-vector interactions.

Potential Functional Roles in Pathogenesis:

  • Cell Invasion and Attachment:
    Membrane proteins in rickettsial pathogens often mediate attachment to host cells. RF_0958 may participate in:

    • Initial adherence to host cell surfaces

    • Interactions with host receptors that facilitate invasion

    • Formation of specialized attachment structures

  • Immune Evasion:
    As a surface-exposed protein, RF_0958 might contribute to immune evasion through:

    • Antigenic variation to evade antibody recognition

    • Disruption of host immune signaling pathways

    • Interfering with complement activation or phagocytosis

  • Vector Adaptation:
    The protein may play a role in vector-specific interactions:

    • Adaptation to flea midgut environment

    • Facilitation of transovarial transmission in arthropod vectors

    • Response to environmental cues during vector-host transitions

Hypothesized FunctionSupporting EvidenceExperimental Approaches to InvestigatePotential Applications
Host cell adhesionMembrane localization, presence of potential binding motifsAdhesion inhibition assays, mutagenesis studiesAnti-adhesion therapeutics
Immune modulationSurface exposure, variability in immune-exposed regionsHost immune response profiling, neutrophil/macrophage interaction studiesVaccine development
Vector colonizationConservation among flea-transmitted RickettsiaComparative genomics, vector competence studiesVector control strategies

The development of specific detection assays for R. felis, such as the RfelB qPCR assay, has highlighted the importance of distinguishing R. felis from closely related but potentially non-pathogenic RFLO species . This suggests that specific proteins like RF_0958 may contribute to the pathogenic potential of R. felis, making them important targets for diagnostic development and pathogenesis research.

Further investigation of RF_0958 function would benefit from comparative analysis with homologous proteins in other Rickettsia species, as well as experimental studies using techniques such as gene knockout, protein localization, and host-pathogen interaction assays to determine its specific role in R. felis biology and pathogenesis.

What emerging technologies might advance our understanding of RF_0958 function?

Several cutting-edge technologies and approaches have the potential to significantly enhance our understanding of RF_0958 structure, function, and role in Rickettsia felis biology:

Emerging Methodologies for RF_0958 Research:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Allows visualization of membrane proteins in near-native states without crystallization

    • Can reveal structural details of RF_0958 alone or in complex with interaction partners

    • Single-particle analysis and tomography approaches can provide complementary structural insights

  • CRISPR-Cas9 Genome Editing in Rickettsia:

    • Recent advances in genetic manipulation of obligate intracellular bacteria

    • Potential for creating RF_0958 knockout or modified strains

    • Enables precise assessment of the protein's role in bacterial survival and pathogenesis

  • Proximity Labeling Proteomics:

    • BioID or APEX2 fusion proteins to identify proteins in close proximity to RF_0958

    • Maps the protein interaction network of RF_0958 in living cells

    • Reveals temporal dynamics of interactions during infection

  • Single-Cell Approaches:

    • Single-cell RNA-seq to examine host response to RF_0958

    • Spatial transcriptomics to map host responses in infected tissues

    • CyTOF (mass cytometry) for high-dimensional analysis of host-pathogen interactions

TechnologyApplication to RF_0958 ResearchTechnical RequirementsExpected Knowledge Gain
Cryo-EMStructural determinationPurified protein, specialized equipment3D structure at near-atomic resolution
CRISPR-Cas9Functional validationGenetic tools for Rickettsia, cell cultureEssential vs. non-essential functions
Proximity labelingInteraction network mappingExpression constructs, mass spectrometryProtein-protein interactions in cellular context
AlphaFold2 + MDComputational structure-functionComputing resources, modeling expertiseDynamic behavior, ligand binding sites

These emerging technologies could help address key questions about RF_0958, including its structural features, binding partners, and contribution to R. felis virulence. The integration of computational approaches with experimental validation will be particularly valuable for membrane proteins like RF_0958, where traditional structural biology approaches face significant challenges.

How might RF_0958 be utilized in developing new diagnostic tools or therapeutic approaches for Rickettsia felis infections?

RF_0958 shows potential as a target for both diagnostic development and therapeutic intervention against Rickettsia felis infections:

Diagnostic Applications:

  • Serological Diagnostics:

    • Recombinant RF_0958 could serve as an antigen in ELISA-based serological tests

    • Potential for increased specificity compared to whole-cell antigen preparations

    • Useful for epidemiological surveillance in endemic regions

  • Molecular Diagnostics:

    • Specific detection of the RF_0958 gene through optimized qPCR assays

    • Development of isothermal amplification methods (LAMP, RPA) for point-of-care testing

    • Multiplex assays targeting RF_0958 and other markers to differentiate R. felis from RFLOs

  • Next-Generation Sequencing Applications:

    • Targeted sequencing of RF_0958 for strain typing

    • Metagenomic approaches to detect R. felis in complex samples

    • Evolutionary analysis to track transmission patterns

Therapeutic Approaches:

  • Vaccine Development:

    • Recombinant RF_0958 as a subunit vaccine candidate

    • Identification of immunodominant epitopes for epitope-based vaccines

    • DNA vaccines encoding RF_0958 for inducing cell-mediated immunity

  • Targeted Drug Development:

    • Structure-based virtual screening for small molecules targeting RF_0958

    • Peptide inhibitors designed to disrupt RF_0958 interactions

    • Antibody-based therapeutics targeting surface-exposed regions

ApplicationDevelopment StageValidation RequirementsImplementation Challenges
ELISA diagnosticsProof-of-conceptSensitivity/specificity testing with clinical samplesCross-reactivity with other Rickettsia species
qPCR assaysAdvanced (similar assays exist) Limit of detection, reproducibilitySample preparation, inhibitor removal
Subunit vaccinesEarly researchAnimal models, immunogenicity studiesAdjuvant selection, delivery system
Small molecule inhibitorsTarget validationIn vitro activity, cytotoxicityMembrane protein druggability

The development of the RfelB qPCR assay demonstrates the importance of specific molecular tools for accurate detection of R. felis, particularly in differentiating it from closely related RFLOs . This emphasizes the potential value of RF_0958-based diagnostics that could provide similar specificity while targeting a different genetic marker for confirmatory testing.

For therapeutic development, the recombinant RF_0958 protein would provide a valuable research tool for screening potential inhibitors and characterizing immune responses, supporting efforts to develop interventions against flea-borne spotted fever caused by R. felis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.