Recombinant Rickettsia massiliae Protein translocase subunit SecF (secF) is a recombinant protein derived from the bacterium Rickettsia massiliae, which is an obligate intracellular alpha-proteobacterium causing spotted fever in humans . The SecF protein is part of the Sec protein translocase complex, crucial for integrating membrane proteins and facilitating protein secretion across bacterial membranes .
SecF is an auxiliary subunit of the Sec protein translocase complex, which plays a vital role in the integration of membrane proteins and the secretion of proteins across the bacterial inner membrane. It interacts with the SecYEG preprotein conducting channel and is involved in the late stages of protein translocation, utilizing the proton motive force (PMF) to complete the translocation process after the ATP-dependent function of SecA .
Sequence and Structure: The recombinant SecF protein from Rickettsia massiliae has a specific amino acid sequence (e.g., MQIYPLRLLPNKIDFDFMNFKKVSYTFSIILSLISFIWIGIYKFNFGIDFAGGIVIEVRL...) . It is typically produced in a recombinant form for research purposes.
Production and Storage: The recombinant protein is available in various quantities, typically stored in a Tris-based buffer with 50% glycerol at -20°C to maintain stability .
Applications: Recombinant SecF proteins are used in ELISA assays for detecting antibodies or studying protein interactions. They are also valuable tools for understanding the mechanisms of protein secretion in bacteria.
| Characteristic | Description |
|---|---|
| Species | Rickettsia massiliae |
| Protein Name | Protein translocase subunit SecF |
| Gene Name | secF |
| Ordered Locus Name | RMA_0161 |
| Sequence Length | 308 amino acids |
| Storage Buffer | Tris-based buffer, 50% glycerol |
| Storage Conditions | -20°C or -80°C for extended storage |
| Applications | ELISA assays, protein interaction studies |
KEGG: rms:RMA_0161
Rickettsia massiliae is a spotted fever group (SFG) rickettsial species that causes mild spotted fever rickettsiosis in humans. Despite sharing >98% genomic identity in coding sequences with the highly virulent R. conorii (which causes Mediterranean spotted fever with mortality rates up to 30%), R. massiliae exhibits dramatically reduced virulence . Phylogenomic analysis reveals that R. massiliae and other milder Rickettsia species diverged from more virulent species (including R. conorii) into distinct evolutionary clades .
R. massiliae has several distinguishing features compared to more virulent Rickettsia species:
Induces elevated MCP-1 (monocyte chemoattractant protein-1) rather than the IL-8 and IL-6 elevation seen with R. conorii
Does not cause endothelial cell death or injury, unlike R. conorii which causes significant cell death at 72 hours post-infection
Maintains normal endothelial barrier function rather than increasing permeability
Contains significantly more mobilome genes (40-43) compared to R. conorii (5)
Harbors plasmids, which are typically absent in more virulent Rickettsia species
The SecF protein functions as a critical component of the bacterial Sec protein translocation system, which is essential for:
Facilitating transport of proteins across the bacterial cytoplasmic membrane
Assisting in the insertion of membrane proteins into the lipid bilayer
Contributing to bacterial survival through proper protein localization
SecF works in conjunction with other Sec pathway components (including SecD, SecY, and SecE) to form a translocation channel. The protein specifically helps with the later stages of translocation, assisting in the release of proteins from the channel and potentially in the recycling of the SecA motor protein.
In R. massiliae, SecF is encoded by the secF gene (locus RMA_0161) and functions as an integral membrane protein with multiple transmembrane domains .
Although direct evidence specifically linking SecF to virulence differences is limited, several potential mechanisms can be proposed:
Altered secretion efficiency: Variations in SecF structure between species may affect the efficiency of virulence factor secretion or membrane protein insertion, influencing host-pathogen interactions .
Membrane composition effects: Differences in SecF function could alter bacterial membrane protein composition, affecting surface antigen presentation and host cell interactions .
Evolutionary context: The reductive evolution observed in more virulent rickettsial species like R. conorii has resulted in genome minimization but potentially optimized protein secretion systems for enhanced pathogenicity .
Integration with virulence systems: The Sec pathway interacts with other bacterial systems involved in host interaction; variations in SecF could affect these interactions .
Comparative analysis of core proteins between R. massiliae and R. conorii reveals significant structural variations, with approximately 9,800 non-synonymous mutations and 1,500 insertions/deletions when comparing between these species . These variations likely extend to SecF and could influence its function in ways that contribute to differential virulence.
Several complementary approaches are recommended for comprehensive structure-function analysis:
X-ray crystallography of purified SecF (challenging for membrane proteins)
Cryo-electron microscopy for visualization of the Sec complex
Hydrogen-deuterium exchange mass spectrometry to map dynamic regions
Computational modeling based on homologous structures
Site-directed mutagenesis of conserved residues followed by functional assays
Chimeric protein construction swapping domains between SecF from different Rickettsia species
In vitro reconstitution of the Sec system with purified components
SecF depletion and complementation studies in model systems
Side-by-side analysis of SecF from R. massiliae and R. conorii
Heterologous expression to compare function in standardized backgrounds
Cross-species complementation studies
Fluorescence resonance energy transfer (FRET) to monitor interactions
Surface plasmon resonance to measure binding kinetics
Thermostability assays to assess structural integrity
Each approach provides different insights, and combining multiple methods offers the most comprehensive understanding of SecF structure-function relationships.
The genomic and regulatory environment of secF may significantly influence its function:
Operon organization: Differences in genetic context may affect co-expression with other Sec components, influencing stoichiometry and assembly of the translocation complex .
Regulatory elements: Variations in promoter regions, transcription factor binding sites, or small RNA regulation could alter expression patterns during infection .
Genomic reduction impact: The more extensive genome reduction in virulent species like R. conorii may have eliminated redundant systems, potentially making remaining secretion pathways more essential and optimized .
Plasmid influence: R. massiliae harbors plasmids with additional genes that may interact with chromosome-encoded systems like SecF, while R. conorii lacks plasmids .
Horizontal gene transfer: The higher number of mobilome genes in R. massiliae (40-43 versus 5 in R. conorii) suggests different evolutionary histories that may have affected secretion system components .
Comparative genomic analysis shows that virulent and milder Rickettsia species have diverged into distinct evolutionary clades, with the former experiencing more extensive genome reduction . This divergence likely extends to protein secretion systems, including regulatory mechanisms controlling SecF expression and function.
| System | Advantages | Considerations |
|---|---|---|
| E. coli C41/C43(DE3) | Optimized for membrane proteins | May require codon optimization |
| Cell-free expression | Avoids toxicity issues | Higher cost, lower yield |
| Insect cell systems | Better for complex proteins | More complex workflow |
Membrane preparation
Cultivate expression host under optimized conditions (typically 20°C post-induction)
Harvest cells and disrupt by sonication or microfluidization
Isolate membrane fraction by ultracentrifugation (100,000×g)
Solubilization screening
Test multiple detergents (DDM, LMNG, DM) for optimal extraction
Solubilize membranes for 1-2 hours at 4°C with gentle agitation
Remove insoluble material by ultracentrifugation
Purification steps
IMAC (Immobilized Metal Affinity Chromatography) using His-tag
Size exclusion chromatography for further purification
Optional ion exchange chromatography for higher purity
Stabilization strategies
Quality control
SDS-PAGE and Western blotting
Mass spectrometry for accurate mass determination
Circular dichroism to assess secondary structure content
Rigorous experimental design requires comprehensive controls:
Well-characterized SecF from model organisms (E. coli, B. subtilis)
Known Sec-dependent proteins that reliably demonstrate translocation
Commercial or well-characterized Sec components to establish baseline activity
Heat-inactivated SecF protein
Site-directed mutants in known critical residues
Proteins lacking signal sequences (non-Sec substrates)
Buffer and detergent-only controls
Other membrane proteins of similar size/structure but different function
SecF from closely related Rickettsia species with different virulence
Pre-immune sera for antibody experiments
Multiple independent protein preparations
Alternative assay methods measuring the same parameter
Dose-response relationships for SecF concentration
Cross-species complementation assays
Statistical analysis of replicate experiments (minimum n=3)
Appropriate normalization to account for batch-to-batch variation
Blinded analysis when possible to avoid bias
For optimal stability and activity preservation of recombinant R. massiliae SecF:
Store at -20°C for regular storage or -80°C for extended storage
Use a Tris-based buffer with 50% glycerol, optimized for protein stability
Aliquot in small volumes (10-20 μL) to minimize freeze-thaw cycles
For reconstituted proteoliposomes, store at -80°C after flash-freezing in liquid nitrogen
Include reducing agents (DTT or TCEP) to prevent oxidation of cysteine residues
Consider adding protease inhibitors for longer storage periods
Monitor stability through activity assays before experimental use
Comparative analysis of SecF across Rickettsia species provides valuable insights into pathogen evolution:
Virulence divergence mechanisms: The phylogenomic tree performed from 330 concatenated core genes revealed that pathogenic Rickettsia species diverged from a common ancestor into two major clades that distinguish virulent species from milder species . This divergence appears more ancient than those which occurred between species within each virulence category.
Reductive evolution signatures: Analysis showed that virulent rickettsial species (including R. conorii) display several genes in a gradual degradation process or lost completely, while milder species (including R. massiliae) exhibit several conserved genes . This pattern extends to protein secretion systems.
Functional adaptation evidence: The two virulent agents exhibited more conservation in their core genes with higher average amino acid identity and significantly fewer non-synonymous mutations and insertions/deletions compared to milder species .
Host adaptation patterns: Different selective pressures based on tick vectors (Rhipicephalus vs. Dermacentor) and mammalian hosts may have shaped SecF evolution differently across lineages .
Mobilome influence: Virulent species like R. conorii have significantly fewer mobilome genes (5) compared to milder species like R. massiliae (40-43), suggesting different evolutionary trajectories that likely affected secretion systems .
This comparative approach reveals how protein secretion machinery evolution correlates with pathogenicity, providing fundamental insights into mechanisms of bacterial virulence evolution.
Host responses to R. massiliae and R. conorii differ dramatically despite their genomic similarity, potentially involving SecF-dependent mechanisms:
| Response Parameter | R. massiliae (Milder) | R. conorii (Virulent) | Potential SecF Involvement |
|---|---|---|---|
| Cytokine profile | Elevated MCP-1 | Elevated IL-8 and IL-6 | SecF-dependent secretion of immunomodulatory factors |
| Endothelial cell viability | No significant cell death | Significant cell death at 72h | Translocation of cytotoxic factors or surface proteins |
| Endothelial permeability | Normal barrier function | Increased permeability | SecF-dependent membrane protein insertion affecting junctions |
| Cell death mechanisms | No significant activation | Caspase-1 dependent | Differential secretion of inflammasome modulators |
R. conorii causes significant endothelial cell death and increased permeability at 72 hours post-infection, while R. massiliae does not induce these pathological changes . These differences may partly result from variations in SecF-dependent protein translocation affecting:
Surface protein composition: Different efficiency in transporting adhesins or invasins that interact with host cells
Effector protein secretion: Variation in secretion of factors that modulate host cell signaling
Immunomodulatory factors: Differential transport of proteins that manipulate host immune responses
Membrane integrity modulators: Factors affecting host cell membrane integrity and function
The substantially different clinical outcomes between infections (mild disease with R. massiliae versus potentially fatal Mediterranean spotted fever with R. conorii) likely involve these host response differences, with protein secretion systems playing a contributory role .
Several cutting-edge technologies hold promise for deeper insights into SecF function:
Cryo-electron tomography: Visualizing SecF in its native membrane environment within intact Rickettsia cells
Single-molecule FRET: Real-time observation of SecF conformational changes during translocation
Mass photometry: Determining SecF complex stoichiometry and assembly dynamics
AlphaFold and related AI methods: Predicting structural features and interaction interfaces
CRISPR interference systems: Adapted for obligate intracellular bacteria to study SecF in native context
Proximity labeling proteomics: Identifying the SecF interaction network during infection
Microfluidic techniques: Studying real-time protein translocation in reconstituted systems
Native mass spectrometry: Analyzing intact membrane protein complexes including SecF
Super-resolution microscopy: Visualizing SecF localization during infection processes
These technologies could help overcome current limitations in studying obligate intracellular bacteria like Rickettsia and provide unprecedented detail on SecF function in pathogenesis.
Insights from R. massiliae SecF research could contribute to therapeutic development in several ways:
Novel drug targets: The essential nature of protein secretion makes SecF a potential target for antimicrobial development. Comparing SecF from species with different virulence may reveal targetable features specific to pathogenic rickettsiae.
Virulence attenuation approaches: Understanding how differences in SecF contribute to reduced virulence of R. massiliae could inform strategies to attenuate virulent Rickettsia species.
Host-directed therapeutics: Insights into how SecF-dependent factors modulate host responses could lead to adjunctive therapies targeting excessive inflammation or vascular damage.
Broad-spectrum applications: The conserved nature of the Sec system across bacteria means that strategies targeting rickettsial SecF might have broader applications against other intracellular pathogens.
Vaccine development: SecF-dependent surface proteins identified through comparative analysis might serve as vaccine antigens, with R. massiliae research helping identify candidates that confer protection without inducing pathological responses.
The significant differences in clinical outcomes between infections with R. massiliae (mild disease) and R. conorii (potentially fatal) make this comparative approach particularly valuable for identifying therapeutic targets that affect pathogenicity rather than just bacterial viability.