Recombinant Rickettsia massiliae Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rickettsia massiliae Protein Translocase Subunit SecF (secF)

Recombinant Rickettsia massiliae Protein translocase subunit SecF (secF) is a recombinant protein derived from the bacterium Rickettsia massiliae, which is an obligate intracellular alpha-proteobacterium causing spotted fever in humans . The SecF protein is part of the Sec protein translocase complex, crucial for integrating membrane proteins and facilitating protein secretion across bacterial membranes .

Function of SecF in Protein Translocation

SecF is an auxiliary subunit of the Sec protein translocase complex, which plays a vital role in the integration of membrane proteins and the secretion of proteins across the bacterial inner membrane. It interacts with the SecYEG preprotein conducting channel and is involved in the late stages of protein translocation, utilizing the proton motive force (PMF) to complete the translocation process after the ATP-dependent function of SecA .

Characteristics of Recombinant Rickettsia massiliae SecF

  • Sequence and Structure: The recombinant SecF protein from Rickettsia massiliae has a specific amino acid sequence (e.g., MQIYPLRLLPNKIDFDFMNFKKVSYTFSIILSLISFIWIGIYKFNFGIDFAGGIVIEVRL...) . It is typically produced in a recombinant form for research purposes.

  • Production and Storage: The recombinant protein is available in various quantities, typically stored in a Tris-based buffer with 50% glycerol at -20°C to maintain stability .

  • Applications: Recombinant SecF proteins are used in ELISA assays for detecting antibodies or studying protein interactions. They are also valuable tools for understanding the mechanisms of protein secretion in bacteria.

Data Table: Characteristics of Recombinant Rickettsia massiliae SecF

CharacteristicDescription
SpeciesRickettsia massiliae
Protein NameProtein translocase subunit SecF
Gene NamesecF
Ordered Locus NameRMA_0161
Sequence Length308 amino acids
Storage BufferTris-based buffer, 50% glycerol
Storage Conditions-20°C or -80°C for extended storage
ApplicationsELISA assays, protein interaction studies

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request as much as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
secF; RMA_0161; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Rickettsia massiliae (strain Mtu5)
Target Names
secF
Target Protein Sequence
MQIYPLRLLPNKIDFDFMNFKKVSYTFSIILSLISFIWIGIYKFNFGIDFAGGIVIEVRL DQAPDLPKMRGVLGKLGIGEVVLQNFGSERDLSIRFGSSSEENLMKNIELIKASLQSNFP YKFEYRKVDFVGPQVGRQLIEAGAMAMLFSFLAIMVYIWVRFEWYFGLGILIALVHDVIL ALGFMSMTKLDFNLSTIAAVLTIIGYSVNDSVVIYDRIRENLRKYHKKNITEIINLSINE TLSRTILTVITTLLANLALILFGGEAIRSFSVLVFFGIIAGTYSSIFISAPILTMFVNRK FNKKVIER
Uniprot No.

Target Background

Function
Recombinant Rickettsia massiliae Protein translocase subunit SecF (secF) is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links

KEGG: rms:RMA_0161

Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rickettsia massiliae and how does it differ from other pathogenic Rickettsia species?

Rickettsia massiliae is a spotted fever group (SFG) rickettsial species that causes mild spotted fever rickettsiosis in humans. Despite sharing >98% genomic identity in coding sequences with the highly virulent R. conorii (which causes Mediterranean spotted fever with mortality rates up to 30%), R. massiliae exhibits dramatically reduced virulence . Phylogenomic analysis reveals that R. massiliae and other milder Rickettsia species diverged from more virulent species (including R. conorii) into distinct evolutionary clades .

R. massiliae has several distinguishing features compared to more virulent Rickettsia species:

  • Induces elevated MCP-1 (monocyte chemoattractant protein-1) rather than the IL-8 and IL-6 elevation seen with R. conorii

  • Does not cause endothelial cell death or injury, unlike R. conorii which causes significant cell death at 72 hours post-infection

  • Maintains normal endothelial barrier function rather than increasing permeability

  • Contains significantly more mobilome genes (40-43) compared to R. conorii (5)

  • Harbors plasmids, which are typically absent in more virulent Rickettsia species

What is the function of the SecF protein translocase in bacterial physiology?

The SecF protein functions as a critical component of the bacterial Sec protein translocation system, which is essential for:

  • Facilitating transport of proteins across the bacterial cytoplasmic membrane

  • Assisting in the insertion of membrane proteins into the lipid bilayer

  • Contributing to bacterial survival through proper protein localization

SecF works in conjunction with other Sec pathway components (including SecD, SecY, and SecE) to form a translocation channel. The protein specifically helps with the later stages of translocation, assisting in the release of proteins from the channel and potentially in the recycling of the SecA motor protein.

In R. massiliae, SecF is encoded by the secF gene (locus RMA_0161) and functions as an integral membrane protein with multiple transmembrane domains .

How might differences in SecF contribute to the reduced virulence of R. massiliae compared to R. conorii?

Although direct evidence specifically linking SecF to virulence differences is limited, several potential mechanisms can be proposed:

  • Altered secretion efficiency: Variations in SecF structure between species may affect the efficiency of virulence factor secretion or membrane protein insertion, influencing host-pathogen interactions .

  • Membrane composition effects: Differences in SecF function could alter bacterial membrane protein composition, affecting surface antigen presentation and host cell interactions .

  • Evolutionary context: The reductive evolution observed in more virulent rickettsial species like R. conorii has resulted in genome minimization but potentially optimized protein secretion systems for enhanced pathogenicity .

  • Integration with virulence systems: The Sec pathway interacts with other bacterial systems involved in host interaction; variations in SecF could affect these interactions .

Comparative analysis of core proteins between R. massiliae and R. conorii reveals significant structural variations, with approximately 9,800 non-synonymous mutations and 1,500 insertions/deletions when comparing between these species . These variations likely extend to SecF and could influence its function in ways that contribute to differential virulence.

What experimental approaches are most effective for studying the structure-function relationship of R. massiliae SecF?

Several complementary approaches are recommended for comprehensive structure-function analysis:

Structural Determination Methods:

  • X-ray crystallography of purified SecF (challenging for membrane proteins)

  • Cryo-electron microscopy for visualization of the Sec complex

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • Computational modeling based on homologous structures

Functional Analysis:

  • Site-directed mutagenesis of conserved residues followed by functional assays

  • Chimeric protein construction swapping domains between SecF from different Rickettsia species

  • In vitro reconstitution of the Sec system with purified components

  • SecF depletion and complementation studies in model systems

Comparative Approaches:

  • Side-by-side analysis of SecF from R. massiliae and R. conorii

  • Heterologous expression to compare function in standardized backgrounds

  • Cross-species complementation studies

Biophysical Techniques:

  • Fluorescence resonance energy transfer (FRET) to monitor interactions

  • Surface plasmon resonance to measure binding kinetics

  • Thermostability assays to assess structural integrity

Each approach provides different insights, and combining multiple methods offers the most comprehensive understanding of SecF structure-function relationships.

How can differences in genetic context and regulation impact SecF function across Rickettsia species?

The genomic and regulatory environment of secF may significantly influence its function:

  • Operon organization: Differences in genetic context may affect co-expression with other Sec components, influencing stoichiometry and assembly of the translocation complex .

  • Regulatory elements: Variations in promoter regions, transcription factor binding sites, or small RNA regulation could alter expression patterns during infection .

  • Genomic reduction impact: The more extensive genome reduction in virulent species like R. conorii may have eliminated redundant systems, potentially making remaining secretion pathways more essential and optimized .

  • Plasmid influence: R. massiliae harbors plasmids with additional genes that may interact with chromosome-encoded systems like SecF, while R. conorii lacks plasmids .

  • Horizontal gene transfer: The higher number of mobilome genes in R. massiliae (40-43 versus 5 in R. conorii) suggests different evolutionary histories that may have affected secretion system components .

Comparative genomic analysis shows that virulent and milder Rickettsia species have diverged into distinct evolutionary clades, with the former experiencing more extensive genome reduction . This divergence likely extends to protein secretion systems, including regulatory mechanisms controlling SecF expression and function.

Expression Systems:

SystemAdvantagesConsiderations
E. coli C41/C43(DE3)Optimized for membrane proteinsMay require codon optimization
Cell-free expressionAvoids toxicity issuesHigher cost, lower yield
Insect cell systemsBetter for complex proteinsMore complex workflow

Recommended Purification Protocol:

  • Membrane preparation

    • Cultivate expression host under optimized conditions (typically 20°C post-induction)

    • Harvest cells and disrupt by sonication or microfluidization

    • Isolate membrane fraction by ultracentrifugation (100,000×g)

  • Solubilization screening

    • Test multiple detergents (DDM, LMNG, DM) for optimal extraction

    • Solubilize membranes for 1-2 hours at 4°C with gentle agitation

    • Remove insoluble material by ultracentrifugation

  • Purification steps

    • IMAC (Immobilized Metal Affinity Chromatography) using His-tag

    • Size exclusion chromatography for further purification

    • Optional ion exchange chromatography for higher purity

  • Stabilization strategies

    • Reconstitution into nanodiscs or liposomes

    • Addition of stabilizing lipids during purification

    • Inclusion of glycerol (10-15%) in storage buffers

  • Quality control

    • SDS-PAGE and Western blotting

    • Mass spectrometry for accurate mass determination

    • Circular dichroism to assess secondary structure content

What controls and validation steps are essential when studying R. massiliae SecF function?

Rigorous experimental design requires comprehensive controls:

Positive Controls:

  • Well-characterized SecF from model organisms (E. coli, B. subtilis)

  • Known Sec-dependent proteins that reliably demonstrate translocation

  • Commercial or well-characterized Sec components to establish baseline activity

Negative Controls:

  • Heat-inactivated SecF protein

  • Site-directed mutants in known critical residues

  • Proteins lacking signal sequences (non-Sec substrates)

  • Buffer and detergent-only controls

Specificity Controls:

  • Other membrane proteins of similar size/structure but different function

  • SecF from closely related Rickettsia species with different virulence

  • Pre-immune sera for antibody experiments

Validation Approaches:

  • Multiple independent protein preparations

  • Alternative assay methods measuring the same parameter

  • Dose-response relationships for SecF concentration

  • Cross-species complementation assays

Data Analysis Requirements:

  • Statistical analysis of replicate experiments (minimum n=3)

  • Appropriate normalization to account for batch-to-batch variation

  • Blinded analysis when possible to avoid bias

What are the optimal storage conditions for maintaining recombinant R. massiliae SecF stability?

For optimal stability and activity preservation of recombinant R. massiliae SecF:

  • Store at -20°C for regular storage or -80°C for extended storage

  • Use a Tris-based buffer with 50% glycerol, optimized for protein stability

  • Aliquot in small volumes (10-20 μL) to minimize freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For reconstituted proteoliposomes, store at -80°C after flash-freezing in liquid nitrogen

  • Include reducing agents (DTT or TCEP) to prevent oxidation of cysteine residues

  • Consider adding protease inhibitors for longer storage periods

  • Monitor stability through activity assays before experimental use

How can comparative analysis of SecF across Rickettsia species inform evolutionary understanding of bacterial pathogenesis?

Comparative analysis of SecF across Rickettsia species provides valuable insights into pathogen evolution:

  • Virulence divergence mechanisms: The phylogenomic tree performed from 330 concatenated core genes revealed that pathogenic Rickettsia species diverged from a common ancestor into two major clades that distinguish virulent species from milder species . This divergence appears more ancient than those which occurred between species within each virulence category.

  • Reductive evolution signatures: Analysis showed that virulent rickettsial species (including R. conorii) display several genes in a gradual degradation process or lost completely, while milder species (including R. massiliae) exhibit several conserved genes . This pattern extends to protein secretion systems.

  • Functional adaptation evidence: The two virulent agents exhibited more conservation in their core genes with higher average amino acid identity and significantly fewer non-synonymous mutations and insertions/deletions compared to milder species .

  • Host adaptation patterns: Different selective pressures based on tick vectors (Rhipicephalus vs. Dermacentor) and mammalian hosts may have shaped SecF evolution differently across lineages .

  • Mobilome influence: Virulent species like R. conorii have significantly fewer mobilome genes (5) compared to milder species like R. massiliae (40-43), suggesting different evolutionary trajectories that likely affected secretion systems .

This comparative approach reveals how protein secretion machinery evolution correlates with pathogenicity, providing fundamental insights into mechanisms of bacterial virulence evolution.

How does the host cell response differ between infections with R. massiliae versus R. conorii, and what role might SecF play?

Host responses to R. massiliae and R. conorii differ dramatically despite their genomic similarity, potentially involving SecF-dependent mechanisms:

Differential Host Responses:

Response ParameterR. massiliae (Milder)R. conorii (Virulent)Potential SecF Involvement
Cytokine profileElevated MCP-1Elevated IL-8 and IL-6SecF-dependent secretion of immunomodulatory factors
Endothelial cell viabilityNo significant cell deathSignificant cell death at 72hTranslocation of cytotoxic factors or surface proteins
Endothelial permeabilityNormal barrier functionIncreased permeabilitySecF-dependent membrane protein insertion affecting junctions
Cell death mechanismsNo significant activationCaspase-1 dependentDifferential secretion of inflammasome modulators

R. conorii causes significant endothelial cell death and increased permeability at 72 hours post-infection, while R. massiliae does not induce these pathological changes . These differences may partly result from variations in SecF-dependent protein translocation affecting:

  • Surface protein composition: Different efficiency in transporting adhesins or invasins that interact with host cells

  • Effector protein secretion: Variation in secretion of factors that modulate host cell signaling

  • Immunomodulatory factors: Differential transport of proteins that manipulate host immune responses

  • Membrane integrity modulators: Factors affecting host cell membrane integrity and function

The substantially different clinical outcomes between infections (mild disease with R. massiliae versus potentially fatal Mediterranean spotted fever with R. conorii) likely involve these host response differences, with protein secretion systems playing a contributory role .

What emerging technologies might advance our understanding of R. massiliae SecF function?

Several cutting-edge technologies hold promise for deeper insights into SecF function:

  • Cryo-electron tomography: Visualizing SecF in its native membrane environment within intact Rickettsia cells

  • Single-molecule FRET: Real-time observation of SecF conformational changes during translocation

  • Mass photometry: Determining SecF complex stoichiometry and assembly dynamics

  • AlphaFold and related AI methods: Predicting structural features and interaction interfaces

  • CRISPR interference systems: Adapted for obligate intracellular bacteria to study SecF in native context

  • Proximity labeling proteomics: Identifying the SecF interaction network during infection

  • Microfluidic techniques: Studying real-time protein translocation in reconstituted systems

  • Native mass spectrometry: Analyzing intact membrane protein complexes including SecF

  • Super-resolution microscopy: Visualizing SecF localization during infection processes

These technologies could help overcome current limitations in studying obligate intracellular bacteria like Rickettsia and provide unprecedented detail on SecF function in pathogenesis.

How might understanding R. massiliae SecF inform therapeutic strategies against rickettsial infections?

Insights from R. massiliae SecF research could contribute to therapeutic development in several ways:

  • Novel drug targets: The essential nature of protein secretion makes SecF a potential target for antimicrobial development. Comparing SecF from species with different virulence may reveal targetable features specific to pathogenic rickettsiae.

  • Virulence attenuation approaches: Understanding how differences in SecF contribute to reduced virulence of R. massiliae could inform strategies to attenuate virulent Rickettsia species.

  • Host-directed therapeutics: Insights into how SecF-dependent factors modulate host responses could lead to adjunctive therapies targeting excessive inflammation or vascular damage.

  • Broad-spectrum applications: The conserved nature of the Sec system across bacteria means that strategies targeting rickettsial SecF might have broader applications against other intracellular pathogens.

  • Vaccine development: SecF-dependent surface proteins identified through comparative analysis might serve as vaccine antigens, with R. massiliae research helping identify candidates that confer protection without inducing pathological responses.

The significant differences in clinical outcomes between infections with R. massiliae (mild disease) and R. conorii (potentially fatal) make this comparative approach particularly valuable for identifying therapeutic targets that affect pathogenicity rather than just bacterial viability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.