Recombinant Rickettsia peacockii Probable intracellular septation protein A (RPR_05830)

Shipped with Ice Packs
In Stock

Description

Genetic and Functional Context

The RPR_05830 gene resides in the TraBE chromosomal region of R. peacockii, flanked by transposase pseudogenes and mobile genetic elements . Key functional insights:

  • Septation Role: Predicted to regulate intracellular septation, a critical step in bacterial cell division. This aligns with homology to Caulobacter crescentus septation proteins involved in membrane invagination .

  • Plasmid Interactions: Genomic studies associate R. peacockii’s plasmid (pRPR) with phospholipid biosynthesis genes, suggesting potential indirect roles in maintaining membrane integrity under glycerol-3-phosphate metabolic constraints .

Recombinant Production and Applications

The recombinant protein is synthesized via heterologous expression in E. coli, enabling high-yield purification for experimental use:

ParameterDetails
Expression VectorpET-based plasmid
Tag10xHis-tag (N-terminal) for affinity chromatography
ReconstitutionSterile deionized water (0.1–1.0 mg/mL) with 50% glycerol for stability
Applications- Antibody development
- Protein-protein interaction studies
- Structural analysis

Research Findings and Implications

  • Pathogen Inhibition: While RPR_05830 itself has not been directly tested, R. peacockii exhibits competitive exclusion of pathogenic Rickettsia parkeri in tick cell cultures, potentially linked to metabolic adaptations involving septation or membrane dynamics .

  • Evolutionary Adaptations: Frameshift mutations in R. peacockii’s glycerol-3-phosphate dehydrogenase gene render it dependent on host-derived metabolites, a constraint possibly mitigated by plasmid-encoded phospholipid biosynthesis genes .

Limitations and Future Directions

Current data rely heavily on bioinformatics predictions due to limited empirical studies on RPR_05830’s mechanistic role. Priority areas include:

  1. Functional Knockout Studies to validate septation involvement.

  2. Structural Resolution via cryo-EM or X-ray crystallography.

  3. Host Interaction Mapping to identify binding partners in tick or mammalian cells .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
yciB; RPR_05830; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Rickettsia peacockii (strain Rustic)
Target Names
RPR_05830
Target Protein Sequence
MLKLLSEIGPVIAFFAGFFYGGGIQHATLYMLITSVICITLCYVIDKKVSKLSIISTTVL LVSGSITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKYALESIVRLKEESWITL SYRTAAFFFFMAVVNEVVWRNCSDETWVKFKVFGVIPITFIFILLQLPLLLKNKLPDSKI
Uniprot No.

Target Background

Function
This protein plays a role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is RPR_05830 and what is its predicted function in Rickettsia peacockii?

RPR_05830 is classified as a probable intracellular septation protein A in Rickettsia peacockii. Based on homology with similar proteins like the ispA gene product in Shigella flexneri, it likely plays a critical role in bacterial cell division, specifically in septum formation during intracellular replication. The protein appears to be essential for proper bacterial morphology and division when replicating within host cells .

The most comparable well-characterized protein is the ispA gene product in Shigella flexneri, which has been experimentally shown to be essential for virulence. When ispA is disrupted in Shigella, it results in increasing defects in cell division, leading to the formation of long filamentous bacteria lacking septa that become trapped within host cells . Given the significant homology between these proteins, RPR_05830 likely serves a similar function in R. peacockii's cell division process.

How is RPR_05830 structurally characterized?

RPR_05830 is predicted to be a small, hydrophobic protein consisting of 180 amino acids . While detailed structural data specific to RPR_05830 is limited, homologous septation proteins like ispA in Shigella flexneri have been characterized as small (21 kDa), very hydrophobic proteins . These characteristics suggest RPR_05830 contains multiple transmembrane domains consistent with membrane association, which would be expected for a protein involved in bacterial septum formation.

The protein is available commercially as a recombinant full-length protein with an N-terminal His-tag expressed in E. coli systems . This suggests that despite its hydrophobic nature, it can be successfully expressed as a recombinant protein, though special considerations for membrane protein purification would likely be necessary.

What is Rickettsia peacockii and how does it relate to other rickettsial species?

Rickettsia peacockii is a non-pathogenic member of the spotted fever group rickettsiae, first identified from Rocky Mountain wood ticks (Dermacentor andersoni) collected in the Sapphire Mountain Range on the eastern side of Bitterroot Valley, Montana . It is also known as the East Side Agent and exists as an endosymbiont in these ticks .

Field studies have shown R. peacockii has a high infection rate in female ticks (66.1%) and is efficiently passed transovarially to offspring (minimal vertical transmission rate of 73.3%) . These characteristics suggest that proteins involved in the bacterium's cell division process, like RPR_05830, are crucial for maintaining this successful endosymbiotic relationship.

What are the recommended approaches for recombinant expression of RPR_05830?

  • Expression system optimization: Use specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3)) to minimize toxicity.

  • Expression conditions: Lower induction temperatures (16-20°C), reduced IPTG concentrations, and longer expression times may improve protein folding and reduce aggregation.

  • Fusion partners: Consider fusion with solubility-enhancing tags like MBP (maltose-binding protein) or SUMO in addition to the His-tag if expression yields are low.

  • Codon optimization: Optimize the coding sequence for E. coli expression, particularly since rickettsial genes often have different codon usage patterns.

A methodical approach to expression optimization is critical since membrane proteins like RPR_05830 can be challenging to express in functional form.

What purification strategies are most effective for recombinant RPR_05830?

Purification of hydrophobic proteins like RPR_05830 requires specialized approaches:

  • Membrane extraction: Gentle cell lysis followed by membrane fraction isolation using ultracentrifugation.

  • Detergent screening: Test multiple detergents (DDM, LDAO, OG, Triton X-100) for optimal solubilization of RPR_05830 from membranes.

  • IMAC purification: Immobilized metal affinity chromatography using Ni-NTA resin with detergent-containing buffers to maintain protein solubility .

  • Size exclusion chromatography: Secondary purification step to ensure protein homogeneity and remove aggregates.

  • Storage optimization: Addition of 5-50% glycerol to final preparations helps maintain stability; commercial preparations are often supplied as lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

Researchers should be aware that repeated freeze-thaw cycles can damage membrane proteins, so aliquoting and proper storage conditions are essential for maintaining protein integrity .

How can functional assays for RPR_05830 be designed based on its predicted role in septation?

Designing functional assays for RPR_05830 should consider its predicted role in bacterial cell division:

  • Complementation studies: Express RPR_05830 in bacterial strains with mutations in homologous septation genes (like ispA mutants in Shigella) to assess functional conservation.

  • Bacterial two-hybrid or pull-down assays: Identify protein-protein interactions with other components of the bacterial division machinery.

  • Microscopy-based assays: Use fluorescently tagged RPR_05830 to visualize localization during different stages of the bacterial cell cycle.

  • In vitro membrane binding assays: Assess the ability of purified RPR_05830 to associate with artificial membrane systems.

  • Structural integrity assessment: Use circular dichroism or limited proteolysis to confirm proper folding of the recombinant protein before functional studies.

These approaches can provide valuable insights despite the challenges of working with proteins from obligate intracellular bacteria that cannot be easily cultured in laboratory settings .

How might RPR_05830 contribute to the endosymbiotic lifestyle of R. peacockii in tick hosts?

R. peacockii exhibits a high infection rate in female ticks (66.1%) and efficient transovarial transmission (73.3%) , suggesting that proteins involved in bacterial cell division, like RPR_05830, may have specialized functions in this endosymbiotic relationship:

  • Tick ovarian localization: R. peacockii infections are primarily localized in tick ovarial tissues , suggesting RPR_05830 may function optimally in this specific cellular environment.

  • Vertical transmission: The high efficiency of transovarial passage indicates that septation processes mediated by RPR_05830 must function properly during bacterial replication in developing eggs.

  • Non-pathogenic adaptation: Unlike its pathogenic relatives, R. peacockii does not appear to cause disease in its tick host, suggesting potential modifications in proteins like RPR_05830 that might limit cellular damage during replication.

  • Genome reduction: R. peacockii has undergone significant genome reduction compared to pathogenic rickettsiae , yet has retained RPR_05830, indicating its essential nature for the bacterium's survival as an endosymbiont.

Research approaches comparing RPR_05830 function in different cellular environments could provide insights into how this protein has adapted to support R. peacockii's specialized lifestyle.

What can comparative analysis between RPR_05830 and the ispA gene product in Shigella reveal about bacterial septation mechanisms?

Comparative analysis between RPR_05830 and the well-characterized ispA gene product in Shigella flexneri offers valuable insights into conserved septation mechanisms:

FeatureispA in Shigella flexneriRPR_05830 in Rickettsia peacockiiSignificance
Size21 kDa, small protein~21 kDa predictedConsistent with conserved function
HydrophobicityVery hydrophobicPredicted highly hydrophobicSuggests membrane association
Cellular effect when mutatedLong filamentous bacteria lacking septaUnknown, but likely similarIndicates role in septum formation
Effect on virulenceEssential for intercellular spreadUnknown in non-pathogenic R. peacockiiMay have divergent roles in different species
Actin polymerizationAffects ability to polymerize actinUnknownPotential cytoskeletal interaction

The ispA mutation in Shigella results in bacteria that initially spread intercellularly at normal rates but gradually slow down and cease spreading due to increasing defects in cell division . This leads to formation of long filamentous bacteria trapped within cells. The high degree of similarity suggests RPR_05830 likely plays an analogous role in R. peacockii septation, though potentially adapted for its endosymbiotic lifestyle rather than pathogenesis.

What genomic context surrounds RPR_05830 and how might this influence its expression and function?

Understanding the genomic context of RPR_05830 requires examining the broader genomic features of R. peacockii:

  • Transposon influence: The R. peacockii genome contains numerous ISRpe1 transposons that have mediated significant genomic rearrangements and deletions . The proximity of transposons to RPR_05830 could potentially affect its expression.

  • Plasmid interactions: R. peacockii contains a 26 kb plasmid (pRPR) with 20 putative genes , some involved in phospholipid biosynthesis. While RPR_05830 is chromosomally encoded, potential regulatory interactions with plasmid-encoded factors cannot be ruled out.

  • Metabolic context: R. peacockii has lost numerous metabolic genes compared to other rickettsiae, including a frameshift mutation in the glycerol-3-phosphate dehydrogenase gene . The metabolic environment could influence septation processes that require specific lipids or energy sources.

  • Evolutionary pressure: Comparative genomics across rickettsial species could reveal whether RPR_05830 has been subject to purifying selection (indicating functional conservation) or positive selection (suggesting adaptive evolution).

Genomic context analysis represents an important avenue for understanding the regulatory mechanisms controlling RPR_05830 expression and its integration with other cellular processes.

What are the major technical barriers to studying RPR_05830 function in vivo?

Research on proteins from obligate intracellular bacteria like Rickettsia faces several significant challenges:

  • Transformation limitations: Extremely low transformation efficiency in rickettsiae makes genetic manipulation challenging . This limits the ability to create RPR_05830 knockout or tagged variants in the native organism.

  • Culture requirements: As obligate intracellular bacteria, rickettsiae require host cells for propagation, complicating the isolation of sufficient material for biochemical studies.

  • Lack of genetic tools: While some progress has been made in developing genetic tools for Rickettsia, the field still lacks many of the sophisticated molecular biology approaches available for model organisms .

  • Transposon mutagenesis limitations: The number of mutants needed for genome-wide screens is not currently feasible given the extremely low transformation efficiency in rickettsiae .

Recent advances that may help overcome these barriers include the potential adaptation of CRISPR-based genome editing technologies, which have been employed in other difficult-to-manipulate bacterial species .

How can heterologous expression systems be optimized to study RPR_05830 function?

Given the challenges of studying RPR_05830 in its native context, optimized heterologous expression systems offer valuable alternatives:

  • Surrogate bacterial hosts: Express RPR_05830 in genetically tractable bacteria with mutations in homologous septation genes to assess functional complementation.

  • Cell-free expression systems: Utilize cell-free protein synthesis platforms optimized for membrane proteins to produce RPR_05830 in the presence of artificial membranes or nanodiscs.

  • Eukaryotic cell models: Express fluorescently tagged RPR_05830 in cultured tick cells to observe its localization and potential interactions in a more native-like environment.

  • Split reporter systems: Use protein fragment complementation assays to identify protein-protein interactions in living cells without disrupting the membrane association of RPR_05830.

  • Conditional expression: Develop tightly regulated inducible expression systems to control RPR_05830 levels, allowing observation of phenotypic effects at different protein concentrations.

These approaches can provide valuable insights while circumventing the difficulties of direct genetic manipulation in Rickettsia species.

What structural biology approaches are most promising for elucidating RPR_05830 function?

Structural characterization of membrane proteins like RPR_05830 presents unique challenges but can provide critical insights into function:

  • Cryo-electron microscopy: Single-particle cryo-EM can determine structures of membrane proteins in detergent micelles or nanodiscs without requiring crystallization.

  • NMR spectroscopy: Solution NMR techniques optimized for membrane proteins can provide dynamic information about protein conformation and interactions.

  • X-ray crystallography: While challenging for membrane proteins, specialized crystallization techniques using lipidic cubic phase or bicelles might be applicable.

  • Computational modeling: Utilize advanced protein structure prediction algorithms like AlphaFold2 to generate models based on homology with better-characterized septation proteins.

  • Hydrogen-deuterium exchange mass spectrometry: Map regions of RPR_05830 that interact with membranes or binding partners without requiring complete structural determination.

These complementary approaches can build a comprehensive understanding of RPR_05830 structure-function relationships despite the challenges inherent in working with membrane proteins from obligate intracellular bacteria.

How might comparative genomics across rickettsial species advance our understanding of RPR_05830 evolution?

Comparative genomics approaches offer powerful opportunities to understand RPR_05830 evolution:

  • Phylogenetic analysis: Construct phylogenetic trees of RPR_05830 homologs across the rickettsial family to identify patterns of conservation and divergence.

  • Selection pressure analysis: Calculate dN/dS ratios (non-synonymous to synonymous substitution rates) to identify regions under purifying or positive selection.

  • Domain architecture comparison: Compare functional domains between pathogenic and non-pathogenic rickettsiae to identify potential adaptations for different lifestyles.

  • Synteny analysis: Examine the conservation of gene order surrounding RPR_05830 across species to identify potentially co-regulated genes.

  • Horizontal gene transfer assessment: Determine whether RPR_05830 shows evidence of horizontal acquisition, particularly given the prevalence of transposons in the R. peacockii genome .

The R. peacockii genome has undergone significant restructuring compared to pathogenic rickettsiae, with 71.4% of deletions greater than 100 bp being flanked by ISRpe1 transposons . Understanding how RPR_05830 has been maintained despite this genomic flux would provide insights into its essential function.

What potential applications might arise from detailed characterization of RPR_05830?

Comprehensive characterization of RPR_05830 could lead to several valuable applications:

  • Novel antimicrobial targets: Understanding septation processes in rickettsiae could identify targets for new antibiotics against pathogenic species.

  • Tick control strategies: Insights into R. peacockii's endosymbiotic relationship might suggest approaches to disrupt transmission of tick-borne pathogens.

  • Heterologous expression systems: Knowledge gained about rickettsial membrane proteins could improve expression systems for other challenging membrane proteins.

  • Bioengineering applications: Insights into bacterial septation mechanisms might be applicable to synthetic biology approaches for controlling bacterial replication.

  • Evolutionary insights: A deeper understanding of septation protein evolution could illuminate broader patterns in the adaptation of obligate intracellular bacteria to their hosts.

These applications highlight the importance of basic research on proteins like RPR_05830, even from non-pathogenic organisms like R. peacockii.

How might emerging genetic tools advance functional studies of RPR_05830?

Recent advances in genetic manipulation technologies offer new possibilities for studying proteins in previously intractable bacterial systems:

  • CRISPR-Cas adaptation: Customized CRISPR-Cas systems optimized for rickettsiae could enable targeted genome editing to create RPR_05830 variants or knockouts .

  • Site-specific recombination systems: Development of rickettsial-specific recombinases could facilitate controlled genetic modifications.

  • Conditional expression systems: Creation of tightly regulated inducible promoters for rickettsiae would allow temporal control of RPR_05830 expression.

  • Single-cell analysis techniques: Application of emerging single-cell technologies could reveal cell-to-cell variability in RPR_05830 expression and function within populations.

  • Improved transformation protocols: Development of more efficient transformation methods for rickettsiae would overcome a major hurdle in genetic manipulation .

The adaptation of these emerging technologies to rickettsial systems would significantly advance our ability to conduct detailed functional studies of proteins like RPR_05830 in their native context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.