Recombinant Rickettsia prowazekii NAD (P) transhydrogenase subunit alpha part 2

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Rickettsia prowazekii NAD(P) transhydrogenase subunit alpha part 2 is a protein component of the enzyme NAD(P) transhydrogenase found in Rickettsia prowazekii . Rickettsia prowazekii is an obligate intracellular bacterium that causes epidemic typhus . NAD(P) transhydrogenase, an enzyme with the EC number 1.6.1.2, is crucial for cellular metabolism because it catalyzes the transfer of hydride ions between NADH and NADP .

Function and Role

The NAD(P) transhydrogenase enzyme, of which the subunit alpha part 2 is a component, couples the transhydrogenation between NADH and NADP to respiration and ATP hydrolysis and functions as a proton pump across the membrane . This activity is important for maintaining the balance of NADPH and NADH, which are essential for various metabolic processes, including oxidative stress response, biosynthesis, and energy metabolism .

Metabolic Context

Rickettsia prowazekii has a limited metabolic capacity, lacking glycolysis and the biosynthesis of pentose phosphates, amino acids, and nucleotides . It relies on importing host metabolites to compensate for its reduced metabolic pathways . The TCA cycle, which uses acetyl-CoA to generate energy, is central to its metabolism . Pyruvate, obtained from the host, is essential for generating phosphoenolpyruvate (PEP), a cofactor in peptidoglycan (PGN) and lipopolysaccharide (LPS) biosynthesis .

Research Applications

Recombinant Rickettsia prowazekii NAD(P) transhydrogenase subunit alpha part 2 is used in research for various purposes:

  • ** изучение бактериальных метаболических процессов**: Для изучения метаболизма Rickettsia prowazekii и роли NAD(P) транcгидрогеназы в энергетическом обмене и антиоксидантной защите .

  • ** Разработка лекарств**: в качестве мишени для разработки новых антибиотиков, нацеленных на метаболические процессы бактерий .

  • Структурные исследования: для определения трехмерной структуры белка и изучения его взаимодействия с другими молекулами .

Key Metabolites and Transport

MetaboliteRole
Glutamate (Glu)Energy source, metabolic flux among Glu, Gln, and 2-oxaloglutarate
Glutamine (Gln)Energy source, most abundant free amino acid in human blood
PyruvateUsed in DAP biosynthesis and for the generation of phosphoenolpyruvate (PEP)
Acetyl-CoAPrimarily used for the TCA cycle and fatty acid biosynthesis
UDP-NAGEnters pathways for PGN and LPS biosynthesis
Dihydroxyacetone Phosphate (DHAP)Glycerophospholipid precursor
sn-Glycerol 3-Phosphate (G3P)Glycerophospholipid precursor
CoACofactor acquired from the host, required for acetyl-CoA generation from acetate and PDC activity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a particular tag, please specify it to allow for preferential development.
Synonyms
pntAB; RP862; NAD(P transhydrogenase subunit alpha part 2; Nicotinamide nucleotide transhydrogenase subunit alpha 2; Pyridine nucleotide transhydrogenase subunit alpha 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Rickettsia prowazekii (strain Madrid E)
Target Names
pntAB
Target Protein Sequence
MNQLPIMAKQAAEIASNAQELSNKLKDLVIDASWQTNTNTIDPLVFAITIFVLASFVGYY VVWKVTPALHTPLMSITNAISGIIVISSMIAITSSSAFEFSSLLGSFATLLASINIFGGF IVTTRMLEMFKK
Uniprot No.

Target Background

Function
This NAD(P) transhydrogenase subunit alpha part 2 catalyzes the transhydrogenation between NADH and NADP+. This process is coupled to respiration and ATP hydrolysis, functioning as a proton pump across the membrane.
Database Links

KEGG: rpr:RP862

STRING: 272947.RP862

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NAD(P) transhydrogenase in Rickettsia prowazekii?

NAD(P) transhydrogenase in R. prowazekii catalyzes the transhydrogenation between NADH and NADP, a process coupled to respiration and ATP hydrolysis . This enzyme functions as a proton pump across the bacterial membrane, playing a crucial role in energy metabolism and redox balance. The enzyme is part of R. prowazekii's strategy to survive in the nutrient-rich cytoplasmic environment of host cells, where it has evolved to exploit host metabolic pathways while losing many of its own biosynthetic capabilities through reductive evolution . Unlike free-living bacteria, R. prowazekii relies heavily on transport of host cell metabolites, making enzymes like NAD(P) transhydrogenase essential for its survival and pathogenicity.

How does the expression of pntAB gene differ between human and arthropod host cells?

The expression of R. prowazekii genes, including pntAB (which encodes the NAD(P) transhydrogenase), shows notable differences between human and arthropod host cells. Transcriptional profiling reveals that R. prowazekii differentially regulates over 150 genes depending on whether it infects human microvascular endothelial cells (HMECs) or tick (Amblyomma americanum, AAE2) cells . The bacterium also utilizes alternative transcription start sites for 18 genes in a host cell-dependent manner . While specific data for pntAB expression differences aren't provided in the search results, this pattern of host-dependent gene regulation suggests that R. prowazekii adapts its metabolic functions, including NAD(P) transhydrogenase activity, according to the specific cellular environment it encounters during its life cycle.

What are the structural characteristics of NAD(P) transhydrogenase subunit alpha part 2?

The NAD(P) transhydrogenase subunit alpha part 2 from R. prowazekii is a partial protein with specific binding domains for its substrates NADH and NADP . While detailed structural information is not provided in the search results, recombinant forms of this protein typically achieve >85% purity as assessed by SDS-PAGE . The protein can be expressed with various tags depending on experimental needs, including Avi-tag Biotinylated forms where biotin is covalently attached to the 15 amino acid AviTag peptide via E. coli biotin ligase (BirA) . The specific structural features that enable its function as a proton pump and its integration into the membrane would be similar to other bacterial transhydrogenases, with domains for both hydride transfer and proton translocation.

What expression systems are optimal for producing recombinant R. prowazekii NAD(P) transhydrogenase?

Multiple expression systems have been successfully used to produce recombinant R. prowazekii NAD(P) transhydrogenase subunit alpha part 2, each offering distinct advantages depending on research requirements:

Expression SystemProduct Code ExampleAdvantagesConsiderations
YeastCSB-YP345959RMY1Post-translational modifications, proper foldingLonger production time
E. coliCSB-EP345959RMY1High yield, cost-effective, rapid productionMay lack proper modifications
E. coli (Biotinylated)CSB-EP345959RMY1-BIn vivo biotinylation via AviTag-BirA technologySpecialized applications requiring biotin-avidin interactions
BaculovirusCSB-BP345959RMY1Complex proteins, eukaryotic modificationsHigher cost, specialized expertise
Mammalian cellCSB-MP345959RMY1Most authentic post-translational modificationsHighest cost, lower yield

The optimal expression system depends on the specific requirements of your research . For basic biochemical characterization, E. coli systems may be sufficient. For studies requiring properly modified and folded protein, especially for interaction studies or structural analyses, mammalian or insect cell systems may be preferable.

What methods are effective for measuring NAD(P) transhydrogenase activity in R. prowazekii?

Measuring NAD(P) transhydrogenase activity in R. prowazekii can be accomplished through several complementary approaches:

  • Spectrophotometric assays: The enzymatic activity can be monitored by following the reduction of NADP+ to NADPH or oxidation of NADH to NAD+ spectrophotometrically, similar to approaches used for other dehydrogenases in R. prowazekii .

  • Purified recombinant enzyme assays: Using purified recombinant NAD(P) transhydrogenase to establish baseline kinetic parameters and compare with activity in cellular extracts .

  • Cell extract activity measurements: R. prowazekii lysed-cell extracts can be prepared using ballistic shearing (e.g., with a Mini-Beadbeater apparatus) followed by centrifugation to clear the lysate . Activity can then be measured by adding appropriate substrates and monitoring spectrophotometrically.

  • Product verification: The identity of reaction products can be verified using techniques such as paper chromatography, HPLC, or mass spectrometry .

When designing these experiments, it's important to consider that R. prowazekii is an obligate intracellular pathogen, making the isolation of active enzymes more challenging than with free-living bacteria.

How can researchers effectively purify R. prowazekii for transcriptional analysis of the pntAB gene?

Effective purification of R. prowazekii for transcriptional analysis of the pntAB gene requires careful isolation to maintain RNA integrity. Based on established methodologies:

  • Infected host cell preparation: Culture either human microvascular endothelial cells (HMECs) or tick cells (AAE2) infected with R. prowazekii under appropriate conditions (37°C or 34°C depending on host) .

  • Rickettsial purification: Carefully isolate R. prowazekii from infected cells using methods such as differential centrifugation or density gradient separation .

  • RNA extraction and quality assessment: Extract total RNA from purified rickettsiae using specialized RNA isolation kits designed for bacterial samples. Assess RNA quality using methods such as Bioanalyzer analysis .

  • Specific gene detection: For pntAB transcript analysis, quantitative reverse transcriptase PCR (qRT-PCR) can be performed using gene-specific primers . The Express Two-Step qRT-PCR system has been successfully applied for rickettsial gene expression analysis .

  • Normalization: For accurate quantification, normalize pntAB expression to validated reference genes like tlc1 .

This approach allows for reliable detection and quantification of pntAB transcripts from different infection models, enabling comparative studies of gene expression under various conditions.

How does NAD(P) transhydrogenase function in R. prowazekii's metabolic adaptation to different host environments?

NAD(P) transhydrogenase likely plays a pivotal role in R. prowazekii's metabolic adaptation to different host environments through several mechanisms:

  • Redox balance maintenance: As R. prowazekii transitions between human and arthropod hosts, it encounters different redox environments. NAD(P) transhydrogenase helps maintain optimal NADPH/NADP+ and NADH/NAD+ ratios critical for cellular functions in these varying conditions .

  • Host-specific metabolic adaptations: Transcriptional profiling has revealed that R. prowazekii differentially expresses over 150 genes between human endothelial cells and tick cells . While specific data for pntAB isn't provided, this pattern suggests the bacterium likely modulates NAD(P) transhydrogenase expression or activity to adapt to host-specific metabolic environments.

  • Energy conservation: As an obligate intracellular pathogen that has undergone reductive evolution, R. prowazekii has lost many biosynthetic pathways and relies heavily on host metabolites . The proton-pumping function of NAD(P) transhydrogenase contributes to energy conservation, which is particularly important given the bacterium's limited metabolic capabilities.

  • Integration with other metabolic pathways: NAD(P) transhydrogenase likely works in concert with other retained metabolic enzymes, such as the GpsA enzyme involved in the sn-glycerol-3-phosphate pathway , to form a tightly integrated metabolic network that maximizes efficiency in different host cell environments.

Understanding these adaptations requires integrated metabolomic, transcriptomic, and functional enzymatic studies across different host cell models.

What role might NAD(P) transhydrogenase play in R. prowazekii pathogenesis and virulence?

NAD(P) transhydrogenase likely contributes to R. prowazekii pathogenesis and virulence through several critical mechanisms:

  • Metabolic homeostasis during infection: By maintaining appropriate NADPH/NADP+ ratios, NAD(P) transhydrogenase supports production of reducing power necessary for biosynthetic reactions and detoxification of reactive oxygen species encountered during infection .

  • Adaptation to host defense mechanisms: When invading human cells, R. prowazekii must counter host immune responses, including oxidative burst. NAD(P) transhydrogenase may help generate sufficient NADPH to power antioxidant systems that neutralize these host defenses .

  • Host-specific gene regulation: R. prowazekii shows differential expression of numerous genes between human and arthropod host cells . This suggests NAD(P) transhydrogenase activity might be regulated as part of a coordinated virulence program tailored to specific host environments.

  • Energy production: The proton-pumping function of NAD(P) transhydrogenase contributes to maintaining membrane potential and energy generation , which is essential for powering virulence factors and maintaining viability within host cells.

  • Integration with sRNA regulation: R. prowazekii expresses numerous small regulatory RNAs that differ between host cell types . These sRNAs may regulate metabolic enzymes including NAD(P) transhydrogenase to optimize virulence in different hosts.

Future research combining transcriptomics, metabolomics, and infection models will be needed to fully elucidate the role of NAD(P) transhydrogenase in rickettsial pathogenesis.

How might NAD(P) transhydrogenase interact with other metabolic enzymes in R. prowazekii's reduced genome?

In R. prowazekii's highly reduced genome, NAD(P) transhydrogenase likely forms critical metabolic nodes with other retained enzymes:

  • Integration with succinate dehydrogenase: R. prowazekii retains the gene (sdhA) for succinate dehydrogenase , which generates FADH2 in the TCA cycle. NAD(P) transhydrogenase likely works in concert with this enzyme to maintain optimal redox balance within the bacterium's streamlined metabolic network.

  • Coordination with GpsA pathway: R. prowazekii possesses a functional GpsA enzyme that converts dihydroxyacetone phosphate (DHAP) to sn-glycerol-3-phosphate (G3P) for phospholipid biosynthesis . NAD(P) transhydrogenase may provide necessary reducing equivalents for this and other biosynthetic reactions.

  • Metabolic hub function: Given R. prowazekii's reliance on host-derived metabolites due to loss of glycolytic and gluconeogenic pathways , NAD(P) transhydrogenase likely serves as a critical hub connecting various remaining metabolic modules to maintain cellular homeostasis.

  • Adaptation to metabolite transport systems: R. prowazekii has evolved specialized transport systems for host-derived metabolites, including novel carriers like those for DHAP . NAD(P) transhydrogenase activities are likely coordinated with these transport systems to efficiently process imported substrates.

  • Compensatory roles: In the face of reductive evolution, remaining enzymes like NAD(P) transhydrogenase may have evolved expanded substrate specificities or regulatory functions to compensate for lost metabolic capabilities.

This metabolic integration reflects evolutionary adaptations that allow R. prowazekii to function efficiently despite its dramatically reduced genome, representing a fascinating model of metabolic minimalism.

How does R. prowazekii NAD(P) transhydrogenase compare to homologs in other bacterial species?

R. prowazekii NAD(P) transhydrogenase represents an interesting case of an enzyme retained through reductive evolution, with several distinctive features compared to homologs in other bacteria:

FeatureR. prowazekii NAD(P) transhydrogenaseFree-living bacterial homologs
Genomic contextPresent in highly reduced genome (~834 protein-coding genes) Present in larger genomes with more complete pathways
Metabolic integrationFunctions within streamlined metabolic network with many missing pathways Typically integrates with complete glycolytic/gluconeogenic pathways
Evolutionary pressureHigh selective pressure to maintain function despite genome reductionVariable selective pressure depending on species
Host dependenceCritical for interfacing with host-derived metabolites Often less dependent on host metabolites
RegulationLikely regulated in response to different host environments (human vs. arthropod) Regulation tailored to free-living or facultative lifestyles

While the core catalytic mechanism of NAD(P) transhydrogenase is likely conserved across species, the R. prowazekii enzyme has evolved to function within a highly specialized metabolic context where it must compensate for numerous missing pathways through increased reliance on host resources.

What experimental challenges must be addressed when studying NAD(P) transhydrogenase in obligate intracellular pathogens?

Studying NAD(P) transhydrogenase in obligate intracellular pathogens like R. prowazekii presents unique experimental challenges that require specialized approaches:

  • Organism cultivation: R. prowazekii can only be grown in living host cells or embryonated eggs , making isolation of sufficient quantities for biochemical studies challenging.

  • Protein purification: Separating bacterial proteins from host cell material requires careful purification techniques that preserve enzyme activity, such as the ballistic shearing methods described for R. prowazekii lysates .

  • Functional assays in native context: Assessing enzyme function within living bacteria requires methods to transport substrates across host and bacterial membranes, as demonstrated in transport studies with radiolabeled DHAP .

  • Genetic manipulation limitations: Traditional genetic tools for studying enzyme function are more difficult to apply to obligate intracellular pathogens, requiring specialized approaches such as heterologous expression in model organisms .

  • Host influence considerations: Different host cell environments (human vs. arthropod) significantly affect R. prowazekii gene expression , necessitating studies across multiple host systems to understand enzyme function in context.

  • Temperature effects: R. prowazekii gene expression is sensitive to temperature differences, requiring careful experimental control and comparison of conditions (e.g., 34°C vs. 37°C) .

These challenges necessitate creative experimental designs combining biochemical, molecular, and cellular approaches to fully characterize NAD(P) transhydrogenase function in R. prowazekii.

How can transcriptomics data be integrated with protein function studies for NAD(P) transhydrogenase research?

Integrating transcriptomics with protein function studies for NAD(P) transhydrogenase research requires a multi-layered approach:

  • Correlation of expression with activity: Transcript levels of pntAB measured by RNA-seq or qRT-PCR can be correlated with NAD(P) transhydrogenase enzymatic activity measured in cell lysates to establish expression-function relationships under various conditions.

  • Host-specific expression analysis: Comparing transcriptional profiles between human and arthropod host cells reveals how R. prowazekii differentially regulates pntAB expression . These findings can guide functional studies under physiologically relevant conditions.

  • Co-expression network analysis: Identifying genes co-regulated with pntAB through transcriptomics can reveal functional metabolic modules and regulatory networks involving NAD(P) transhydrogenase.

  • sRNA regulatory mechanisms: R. prowazekii expresses numerous small regulatory RNAs (Rp_sRs) that differ between host cell types . Integrating sRNA and mRNA transcriptomics can identify potential post-transcriptional regulation of NAD(P) transhydrogenase.

  • Alternative transcription start site analysis: R. prowazekii utilizes alternative transcription start sites for 18 genes in a host-dependent manner . Similar analysis of pntAB could reveal condition-specific isoforms with altered function.

  • Metabolic context integration: Combining transcriptomics data for pntAB with that of other metabolic enzymes (like GpsA and SdhA ) provides a systems-level view of adaptive metabolic reconfiguration in different environments.

This integrated approach provides a comprehensive understanding of how transcriptional regulation translates to functional adaptations in NAD(P) transhydrogenase activity across diverse host environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.