Recombinant Rickettsia rickettsii Probable intracellular septation protein A (A1G_03060)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. If you have a specific format preference, please indicate your requirement in the order notes, and we will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice for shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliqouting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of the protein is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
yciB; A1G_03060; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Rickettsia rickettsii (strain Sheila Smith)
Target Names
A1G_03060
Target Protein Sequence
MLKFLSEIGPVIAFFAGFFYGGGIQHATLYMLITSVICITLCYVIDKKVSKLSIISTTVL LVSGSITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKYALESIVRLKEESWITL SYRTAAFFFFMAVVNEVVWRNCSDETWVKFKVFGVIPITFIFILLQLPLLLKNKLPDSKI
Uniprot No.

Target Background

Function
Plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Rickettsia rickettsii Probable intracellular septation protein A (A1G_03060)?

A1G_03060 is a probable intracellular septation protein A from Rickettsia rickettsii (strain Sheila Smith), a Gram-negative obligate intracellular bacterium. This protein consists of 180 amino acids with a molecular mass of 20.418 kDa . It belongs to the YciB family of proteins, which are known to be involved in bacterial cell division processes, particularly intracellular septation .

The protein is predicted to be membrane-associated based on sequence analysis, which aligns with its putative role in septation, a process requiring interaction with the bacterial cell membrane during division. While the exact molecular mechanism of A1G_03060 remains to be fully characterized, its classification suggests it participates in forming the septum during bacterial division, a critical step for successful rickettsial replication within host cells .

Like other members of obligate intracellular bacteria, R. rickettsii has undergone genome reduction yet retained this protein, suggesting its essential nature for bacterial survival and replication within the intracellular environment .

How does recombinant A1G_03060 expression differ from native protein expression in Rickettsia rickettsii?

Recombinant A1G_03060 expression, typically performed in E. coli systems, differs substantially from native expression in R. rickettsii in several important ways:

ParameterNative Expression in R. rickettsiiRecombinant Expression in E. coli
EnvironmentObligate intracellular environmentFree-living bacterial culture system
Expression levelLikely low, controlled by natural promotersHigh, driven by strong inducible promoters
Post-translational modificationsNative modifications specific to RickettsiaMay lack Rickettsia-specific modifications
Folding chaperonesRickettsia-specific folding machineryE. coli chaperone system
Protein interactionsInteraction with native Rickettsia partnersIsolation from natural binding partners
Membrane environmentNative membrane compositionDifferent phospholipid composition in E. coli
Purification approachDifficult to isolate from obligate intracellular bacteriaHis-tag purification using standardized methods

These differences necessitate careful validation of recombinant protein function and structure. Researchers should consider that while recombinant expression provides access to otherwise difficult-to-isolate proteins, the resulting product may not fully recapitulate all aspects of the native protein in its original cellular context. Confirming proper folding and activity is therefore essential when working with recombinant A1G_03060.

What expression systems are most effective for producing functional recombinant A1G_03060?

E. coli expression systems have proven effective for producing recombinant A1G_03060 protein, as evidenced by commercially available preparations . When designing an expression system, researchers should consider:

Recommended expression strategies:

  • Vector selection:

    • pET series vectors with T7 promoters offer high expression levels under IPTG induction

    • Incorporation of N-terminal His-tags facilitates purification while minimizing interference with protein function

    • Consider inclusion of a precision protease cleavage site if tag removal is desired

  • Host strain optimization:

    • E. coli BL21(DE3) serves as a standard expression host

    • C41(DE3) or C43(DE3) strains are specifically designed for membrane protein expression

    • Rosetta or CodonPlus strains address rare codon usage issues

  • Expression conditions:

    • Induction at lower temperatures (16-25°C) improves membrane protein folding

    • Extended expression times (overnight) at lower temperatures may increase yield of properly folded protein

    • Reduced inducer concentration (0.1-0.5 mM IPTG) can prevent aggregation

These approaches have been successfully applied to membrane proteins similar to A1G_03060, though individual optimization may be necessary depending on specific research requirements .

What purification strategies yield the highest purity and activity for recombinant A1G_03060?

For His-tagged recombinant A1G_03060, immobilized metal affinity chromatography (IMAC) serves as the primary purification method . The optimal purification protocol should include:

Recommended purification workflow:

  • Cell lysis and solubilization:

    • Lysis in buffer containing 20-50 mM Tris-HCl (pH 8.0), 300-500 mM NaCl, 10-20 mM imidazole

    • Addition of mild detergents (0.1-1% Triton X-100 or CHAPS) to solubilize membrane-associated proteins

    • Inclusion of protease inhibitors (e.g., 1 mM PMSF, 2 μM pepstatin) to prevent degradation

  • Affinity chromatography:

    • Binding to Ni-NTA or Co²⁺ resin

    • Washing with increasing imidazole concentrations (20-50 mM)

    • Elution with high imidazole concentration (250-500 mM)

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and ensure monodispersity

    • Ion exchange chromatography for removal of contaminating proteins

The resulting protein should achieve greater than 90% purity as determined by SDS-PAGE analysis . Buffer composition during purification significantly impacts protein stability and activity, with optimal conditions including 6% trehalose in Tris/PBS-based buffer at pH 8.0 .

How can researchers verify the proper folding and activity of recombinant A1G_03060?

Verifying proper folding and activity of recombinant A1G_03060 requires multiple complementary approaches:

Structural integrity assessment:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to examine secondary structure elements

    • Differential scanning fluorimetry to evaluate thermal stability

    • Size exclusion chromatography to confirm monodispersity

  • Functional verification approaches:

    • Membrane association assays using artificial liposomes

    • Protein-protein interaction studies with other division proteins

    • Localization studies in bacterial expression systems

  • Comparative analysis methods:

    • Comparison with wild-type protein (if available)

    • Structural homology modeling against related proteins

    • Epitope accessibility testing with conformation-specific antibodies

A multi-faceted approach combining these methods provides comprehensive verification of proper protein folding and retention of functional properties. This is particularly important for membrane proteins like A1G_03060, which are prone to misfolding when expressed recombinantly. Activity assays should be designed based on the protein's predicted function in cell division and septation processes .

Hypothesized roles in pathogenesis:

  • Cell division functions:

    • Participates in septum formation during bacterial division

    • Coordinates with other division proteins to ensure proper segregation of bacterial contents

    • Facilitates efficient bacterial replication within host cells

  • Connection to virulence mechanisms:

    • Efficient bacterial replication within host cells is essential for R. rickettsii pathogenesis

    • R. rickettsii inhibits host cell apoptosis to ensure a stable replication niche

    • Proper cell division is necessary for bacteria to establish infection and spread to adjacent cells

The importance of A1G_03060 is underscored by genome analysis of obligate intracellular bacteria like Rickettsia, which retain only essential proteins during evolutionary genome reduction . As a member of the essential cell division machinery, A1G_03060 likely plays an indirect but crucial role in pathogenesis by enabling bacterial proliferation within the host environment.

How might A1G_03060 interact with host cell factors during infection?

While direct interactions between A1G_03060 and host factors have not been extensively characterized, several mechanisms can be proposed:

Potential host interaction mechanisms:

  • Bacterial division coordination:

    • A1G_03060 may help coordinate bacterial division within specific host cell compartments

    • The protein could respond to host cellular cues that signal favorable conditions for replication

    • Its septation function may be modulated by host cell cycle status

  • Host response considerations:

    • R. rickettsii is known to modulate host cell processes including apoptosis

    • Host immune surveillance may recognize bacterial division components

    • Bacterial septation must avoid triggering host danger signals

  • Investigation approaches:

    • Immunoprecipitation studies in infected cells

    • Proximity-based labeling techniques (BioID, APEX) to identify proteins in close association

    • Cell-selective proteomics as used for other Rickettsia effectors

Understanding these potential interactions could provide insights into how R. rickettsii establishes its intracellular niche and proliferates while evading host defenses. The development of cell-selective proteomics approaches, as demonstrated with R. parkeri , offers promising strategies for identifying interaction partners of A1G_03060 during infection.

What technical challenges arise when working with recombinant A1G_03060 and how can they be overcome?

Researchers working with recombinant A1G_03060 face several technical challenges, particularly due to its properties as a probable membrane protein:

Common challenges and solutions:

ChallengeTechnical Solutions
Limited solubility- Use mild detergents (0.1-1% Triton X-100, CHAPS, or DDM)
- Express as fusion with solubility-enhancing tags (MBP, SUMO)
- Optimize buffer composition with stabilizing agents
Protein misfolding- Lower induction temperature (16-20°C)
- Co-express with chaperone proteins
- Optimize codon usage for expression host
Proteolytic degradation- Include protease inhibitors in all buffers (PMSF, pepstatin)
- Work at 4°C during purification
- Minimize handling time
Aggregation during storage- Add glycerol (5-50%) as cryoprotectant
- Store in small aliquots to minimize freeze-thaw cycles
- Consider lyophilization with appropriate cryoprotectants like trehalose
Activity assessment- Develop membrane association assays
- Design protein-protein interaction studies with division proteins
- Create functional complementation systems

Addressing these challenges with appropriate technical strategies significantly increases the likelihood of obtaining properly folded, functional recombinant A1G_03060 for research applications.

How should recombinant A1G_03060 be stored to maintain stability and activity?

Based on commercial recommendations and general protein storage principles, recombinant A1G_03060 requires specific storage conditions to maintain stability and activity :

Optimal storage protocols:

  • Short-term storage (up to one week):

    • Store at 4°C in appropriate buffer

    • Avoid repeated freeze-thaw cycles that lead to protein denaturation

  • Long-term storage:

    • Store at -20°C or preferably -80°C in small aliquots

    • Incorporate 5-50% glycerol as a cryoprotectant, with 50% being optimal

  • Lyophilization advantages:

    • Lyophilized powder forms offer extended shelf life

    • Include 6% trehalose in Tris/PBS-based buffer (pH 8.0) for optimal results

    • Store lyophilized protein in desiccated conditions

  • Reconstitution protocols:

    • Briefly centrifuge vials before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to final concentration of 5-50% for aliquots intended for freezing

  • Quality control measures:

    • Perform stability tests after reconstitution

    • Check for aggregation using light scattering or size exclusion chromatography

    • Verify activity using appropriate functional assays

These storage recommendations optimize protein stability while minimizing degradation, denaturation, and aggregation, ensuring the recombinant protein remains suitable for downstream experimental applications.

What controls should be included in experiments using recombinant A1G_03060?

Robust experimental design with appropriate controls is essential when working with recombinant A1G_03060:

Essential experimental controls:

  • Positive controls:

    • Well-characterized proteins from the same family (other YciB proteins)

    • Previously validated batches of recombinant A1G_03060

    • Proteins with known behavior in the experimental system

  • Negative controls:

    • Heat-denatured A1G_03060 to confirm specificity of interactions

    • Unrelated proteins with similar size/tags to control for non-specific binding

    • Buffer-only controls to establish baseline measurements

  • Specificity controls:

    • Competitive binding assays with unlabeled protein

    • Mutated versions of A1G_03060 lacking key functional domains

    • Antibody blocking experiments to confirm specificity

  • Technical controls:

    • Multiple protein concentrations to establish dose-dependent effects

    • Different detection methods to confirm observations

    • Replicates to ensure statistical significance

Implementation of these controls ensures the reliability and specificity of results, particularly important when working with proteins of incompletely characterized function like A1G_03060.

How does A1G_03060 compare with similar proteins in other intracellular pathogens?

Comparative analysis of A1G_03060 with related proteins in other pathogens provides evolutionary insights and potential functional conservation:

Comparative analysis findings:

  • Phylogenetic relationships:

    • YciB family proteins are found across diverse bacterial species

    • Rickettsial YciB proteins show closest relationship to those in other alpha-proteobacteria

    • Conservation patterns suggest essential function in bacterial physiology

  • Structural conservation:

    • Predicted transmembrane topology is conserved across species

    • Key amino acid residues in functional domains show high conservation

    • Lineage-specific adaptations reflect specialization for different host environments

  • Functional comparison:

    • Intracellular pathogens utilize septation proteins for coordinated division within host cells

    • R. rickettsii A1G_03060 likely functions similarly to homologs in related pathogens

    • Retention despite genome reduction underscores essential nature

This comparative approach contextualizes A1G_03060 within R. rickettsii's unique intracellular lifestyle, while revealing broader principles of bacterial adaptation to intracellular environments. The conservation of this protein family across diverse bacterial species highlights its fundamental importance in bacterial cell physiology.

What experimental approaches can identify potential binding partners of A1G_03060?

Several complementary high-throughput approaches can help identify the interactome of A1G_03060:

Recommended interaction discovery methods:

  • Affinity purification-mass spectrometry (AP-MS):

    • Immobilize purified A1G_03060 on affinity resin

    • Incubate with bacterial or host cell lysates

    • Identify bound proteins by mass spectrometry

    • Use quantitative approaches (SILAC, TMT) to differentiate specific from non-specific interactions

  • Proximity-based labeling approaches:

    • BioID method: Fuse A1G_03060 to a biotin ligase

    • APEX2 method: Fuse to an engineered peroxidase

    • Express in appropriate bacterial or surrogate systems

    • Identify proteins in proximity through streptavidin pulldown and mass spectrometry

  • Cell-selective BONCAT:

    • Adapt bioorthogonal non-canonical amino acid tagging (BONCAT) as used with R. parkeri

    • Express MetRS* in an appropriate system to enable selective labeling

    • Identify newly synthesized proteins in proximity to A1G_03060

  • Validation strategies:

    • Co-immunoprecipitation of identified interactions

    • Bacterial two-hybrid or split-protein complementation assays

    • Immunofluorescence co-localization studies

    • Functional assays to assess biological relevance of interactions

Integration of data from multiple approaches, followed by validation of key interactions, would provide a comprehensive view of A1G_03060's functional partners in both bacterial and host contexts.

How can genetic approaches be used to study A1G_03060 function in Rickettsia rickettsii?

Genetic manipulation of obligate intracellular bacteria presents unique challenges, but several approaches can be applied to study A1G_03060 function:

Genetic analysis strategies:

  • Transformation approaches:

    • Development of shuttle vectors for introducing genetic constructs

    • Transposon mutagenesis to disrupt gene function

    • Homologous recombination for targeted modifications

  • Gene modification strategies:

    • Complete gene knockout (if non-essential)

    • Introduction of point mutations in critical domains

    • Addition of epitope tags for localization and interaction studies

    • Creation of conditional knockdown systems if the gene proves essential

  • Phenotypic analysis methods:

    • Microscopic examination of division defects

    • Growth curve analysis to quantify replication efficiency

    • Transmission electron microscopy to assess septum formation

    • Infection assays to evaluate effects on host cell invasion and intracellular growth

  • Alternative approaches:

    • Heterologous expression in surrogate bacterial systems

    • Antisense RNA strategies to reduce expression

    • Expression of dominant-negative variants

While technically challenging, successful genetic manipulation would provide definitive insights into A1G_03060 function. Recent advances in genetic tools for obligate intracellular bacteria, including Rickettsia species, have expanded the possibilities for such studies.

What potential applications exist for A1G_03060 in developing therapeutics against Rickettsial infections?

As a protein involved in bacterial cell division, A1G_03060 represents a potential target for developing novel therapeutics against Rickettsial infections:

Therapeutic development approaches:

  • Antimicrobial development strategies:

    • Structure-based design of small molecule inhibitors targeting A1G_03060

    • Peptide-based inhibitors designed to interfere with protein-protein interactions

    • High-throughput screening of compound libraries against recombinant A1G_03060

  • Vaccine development considerations:

    • Assessment of A1G_03060 as a potential vaccine antigen

    • Evaluation of immune responses to recombinant A1G_03060 in animal models

    • Design of subunit vaccines incorporating multiple rickettsial antigens

  • Diagnostic applications:

    • Development of serological tests based on recombinant A1G_03060

    • Use of anti-A1G_03060 antibodies in diagnostic immunohistochemistry

    • PCR-based detection targeting the A1G_03060 gene

  • Target validation approaches:

    • In vitro inhibition studies using recombinant protein

    • Infection models to assess efficacy of targeting A1G_03060

    • Evaluation of resistance potential through structural and genomic analysis

The essential nature of cell division proteins makes A1G_03060 a potentially valuable therapeutic target. Its role in a fundamental bacterial process and its distinction from human proteins could provide the selectivity needed for effective antimicrobial development against these challenging intracellular pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.