Recombinant Rickettsia rickettsii Probable intracellular septation protein A (RrIowa_0644)

Shipped with Ice Packs
In Stock

Description

Role in Bacterial Physiology

RrIowa_0644 is hypothesized to participate in intracellular septation, a critical process for bacterial cell division. While its exact biochemical function remains uncharacterized, studies suggest it localizes to the inner membrane, potentially influencing structural integrity or host-pathogen interactions .

Virulence and Immune Modulation

  • Attenuation Context: The Iowa strain (source of RrIowa_0644) shows minimal replication in human dermal microvascular endothelial cells (HDMECs) compared to virulent strains like Sheila Smith. This attenuation correlates with heightened interferon-beta (IFN-β) responses, which restrict bacterial growth .

  • Comparative Virulence:

    StrainReplication in HDMECsIFN-β SecretionHost Cell Lysis Timing
    Sheila SmithRobustDelayed/LowLate apoptosis (24h+)
    Iowa (RrIowa_0644)MinimalHigh/EarlyEarly necrosis (6–12h)
    R. montanensisNoneUndetectableRapid lysis (6h)
    Reconstitution of Iowa with virulence factors (e.g., RARP2, RapL) reduces IFN-β production and delays host cell death, suggesting RrIowa_0644 may lack immune evasion mechanisms present in pathogenic strains .

Vaccine Development

  • Antigenic Potential: Surface proteins like RrIowa_0644 are explored as vaccine targets. Recombinant R. rickettsii outer membrane proteins (e.g., YbgF) have shown protective efficacy in murine models by inducing IFN-γ-producing T cells and IgG2a antibodies .

  • Challenges: Despite promising preclinical results, no RMSF vaccine exists for humans. Killed whole-cell and subunit vaccines (including recombinant proteins) historically failed to confer robust immunity .

Diagnostic Tools

  • Detection Methods: RrIowa_0644-associated genomic regions are leveraged in loop-mediated isothermal amplification (LAMP) assays for specific identification of R. rickettsii. This gene’s conserved sequence across strains enables high diagnostic specificity .

Technical Considerations for Use

  • Reconstitution: Requires dissolution in deionized water (0.1–1.0 mg/mL) with glycerol (5–50%) for long-term stability .

  • Experimental Limitations: Repeated freeze-thaw cycles degrade functionality, necessitating single-use aliquots .

Knowledge Gaps and Future Directions

  • Mechanistic Studies: The protein’s interaction with host pathways (e.g., Golgi disruption by RARP2 or autotransporter processing by RapL) remains unexplored .

  • Therapeutic Optimization: Engineering RrIowa_0644 with virulence determinants could clarify its role in immune evasion and inform next-generation vaccine design .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format we currently have in stock, we are happy to accommodate your specific requirements. Please indicate any preferences for the format when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please communicate this in advance. Additional fees will apply for this service.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain optimal quality, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
We strive to identify the most suitable tag type during our production process. If you have a specific tag type in mind, please inform us and we will prioritize developing it for your order.
Synonyms
yciB; RrIowa_0644; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Rickettsia rickettsii (strain Iowa)
Target Names
RrIowa_0644
Target Protein Sequence
MLKFLSEIGPVIAFFAGFFYGGGIQHATLYMLITSVICITLCYVIDKKVSKLSIISTTVL LVSGSITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKYALESIVRLKEESWITL SYRTAAFFFFMAVVNEVVWRNCSDETWVKFKVFGVIPITFIFILLQLPLLLKNKLPDSKI
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining the integrity of the cell envelope and regulating membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of Rickettsia rickettsii Probable intracellular septation protein A?

    The Probable intracellular septation protein A (RrIowa_0644) is primarily involved in cell division processes and is likely essential for intracellular septation in Rickettsia rickettsii. It belongs to the YciB protein family, which has been implicated in bacterial cell division . While the exact mechanisms remain under investigation, homologous proteins in other bacteria such as the ispA gene in Shigella flexneri have been shown to be essential for cell division, with mutations leading to the formation of long filamentous bacteria lacking septa . In bacterial pathogens, proper septation is crucial for successful replication within host cells.

  • What are the structural characteristics of RrIowa_0644?

    RrIowa_0644 is a small, highly hydrophobic protein with the following characteristics:

    FeatureDescription
    Length180 amino acids (in Sheila Smith strain)
    Molecular Mass20.418 kDa
    Protein FamilyYciB family
    HydrophobicityVery hydrophobic, likely membrane-associated
    Secondary StructureMultiple transmembrane domains predicted

    The protein's hydrophobic nature suggests it's likely integrated into the bacterial membrane system . Its amino acid sequence indicates multiple hydrophobic regions that likely form transmembrane domains, consistent with its predicted role in septation processes.

  • What expression systems are suitable for producing recombinant RrIowa_0644 protein?

    Several expression systems have been successfully employed for producing Recombinant Rickettsia rickettsii Probable intracellular septation protein A, each with specific advantages:

    Expression SystemAdvantagesConsiderations
    E. coliHigh yield, cost-effective, rapid productionMay require optimization for membrane protein expression
    YeastPost-translational modifications, proper folding of eukaryotic-like featuresLonger production time, potentially lower yield
    BaculovirusExcellent for complex proteins, preserves functionalityMore complex setup, higher cost
    Mammalian cellsMost authentic post-translational modificationsHighest cost, most complex system

    For functional studies, it's methodologically important to select the expression system based on the specific research questions. For structural studies, E. coli may be sufficient, while interaction studies might benefit from eukaryotic expression systems . Additionally, in vivo biotinylation using AviTag-BirA technology in E. coli has been effectively used for this protein, which enables highly specific covalent attachment of biotin to the AviTag peptide .

  • How do researchers confirm the identity and purity of recombinant RrIowa_0644?

    Verification of recombinant RrIowa_0644 protein identity and purity involves multiple analytical approaches:

    • SDS-PAGE analysis: For basic purity assessment (>85% purity is typically expected)

    • Western blotting: Using specific antibodies against the protein or tag

    • Mass spectrometry: For precise molecular weight determination and sequence verification

    • N-terminal sequencing: To confirm the correct start of the protein

    • Dynamic light scattering: To assess homogeneity and aggregation state

    Research-grade recombinant proteins typically require extensive characterization before use in experiments. For applications like antibody production or enzyme activity studies, functional tests should also be performed to ensure the recombinant protein retains native activity.

Advanced Research Questions

  • What methodologies are effective for studying the role of RrIowa_0644 in bacterial cell division?

    Investigating RrIowa_0644's role in bacterial cell division requires specialized approaches due to Rickettsia's obligate intracellular lifestyle:

    1. Fluorescent protein tagging: C-terminal or N-terminal fusions with fluorescent proteins like GFP to visualize protein localization during cell division

    2. Time-lapse microscopy: To track septation dynamics in live infected cells

    3. Immunogold electron microscopy: For precise subcellular localization at nanometer resolution

    4. Genetic manipulation:

      • Insertional mutagenesis (similar to approaches used with R. parkeri)

      • Conditional expression systems to control protein levels

      • CRISPR interference (CRISPRi) for temporal knockdown

    5. Protein-protein interaction studies:

      • Bacterial two-hybrid systems

      • Co-immunoprecipitation with known division proteins

      • Proximity labeling approaches (BioID, APEX)

    When designing these experiments, it's critical to incorporate appropriate controls and consider the timing of sample collection, as R. rickettsii has specific growth dynamics within host cells. The field has benefited from transposon mutagenesis approaches, although challenges remain due to low transformation efficiency and the need for long-term cultivation to recover and characterize mutants .

  • How can researchers design experiments to investigate RrIowa_0644's potential role in pathogenesis?

    Experimental design for investigating RrIowa_0644's role in pathogenesis should follow these methodological steps:

    1. Hypothesis formulation: Based on known functions of YciB family proteins and intracellular septation proteins in other pathogens

    2. Variable identification:

      • Independent variable: RrIowa_0644 expression/mutation status

      • Dependent variables: Bacterial growth, host cell effects, virulence markers

      • Control variables: Host cell type, infection conditions, time points

    3. Experimental approaches:

      • Genetic manipulation: Generate knockdown, knockout, or overexpression strains

      • Infection assays: Compare wild-type vs. modified strains in:

        • Cell culture models (primary endothelial cells preferred)

        • Animal models (if available)

      • Microscopy: Track intracellular growth patterns and morphological changes

      • Transcriptomics/proteomics: Identify downstream effects of manipulation

    4. Control considerations:

      • Include complementation studies to verify phenotypes

      • Use multiple cell types (e.g., HDMEC, Vero76)

      • Compare effects across different R. rickettsii strains (Iowa vs. Sheila Smith)

    5. Measurement methods:

      • Bacterial load quantification (qPCR, fluorescence)

      • Host cell viability assays

      • Cytokine production analysis

      • Cell morphology assessment

    This systematic approach follows sound experimental design principles, ensuring variables are properly controlled and that measurements are reliable and valid .

  • What are the challenges in purifying functional recombinant RrIowa_0644 protein?

    Purification of functional recombinant RrIowa_0644 presents several technical challenges due to its hydrophobic nature:

    1. Solubility issues: As a highly hydrophobic protein with multiple predicted transmembrane domains, RrIowa_0644 tends to aggregate during expression and purification

    2. Expression optimization strategies:

      • Use of specialized E. coli strains (C41(DE3), C43(DE3)) designed for membrane protein expression

      • Expression at lower temperatures (16-20°C) to slow folding and reduce aggregation

      • Addition of solubility-enhancing fusion tags (MBP, SUMO)

    3. Extraction methods:

      • Careful selection of detergents (DDM, LDAO, or Triton X-100) for efficient solubilization

      • Optimization of detergent-to-protein ratios to maintain native structure

      • Consider nanodiscs or amphipols for maintaining functional state

    4. Purification approaches:

      • Affinity chromatography using carefully positioned tags to avoid interference with function

      • Size exclusion chromatography to separate oligomeric states

      • Ion exchange chromatography for final polishing

    5. Activity preservation:

      • Inclusion of stabilizing agents (glycerol, specific lipids)

      • Rapid processing to minimize time in detergent solutions

      • Functional validation assays at each purification step

    When designing purification protocols, researchers should consider that RrIowa_0644's activity may be dependent on specific membrane environments or protein-protein interactions within the bacterial cell. Preparation as a lyophilized powder with appropriate reconstitution methods is recommended for stability .

  • How does the function of RrIowa_0644 compare to YciB family proteins in other bacterial pathogens?

    Comparative analysis of RrIowa_0644 with YciB family proteins in other pathogens reveals important functional parallels:

    OrganismProteinFunctionPhenotype of MutationReference
    R. rickettsiiRrIowa_0644Intracellular septationNot fully characterized
    Shigella flexneriIspAEssential for cell divisionFilamentous bacteria lacking septa; defects in actin polymerization; reduced intercellular spreading
    E. coliYciBMembrane protein biogenesisAffects membrane integrity-
    R. typhiHomologLikely involved in PLA₂ activityAffects host cell interactions

    Functional studies of IspA in Shigella flexneri are particularly relevant, as mutations resulted in avirulent bacteria incapable of spreading throughout epithelial cell monolayers. These mutants initially spread intercellularly at normal rates but gradually slowed down due to increasing defects in cell division, resulting in filamentous bacteria trapped within cells . This suggests RrIowa_0644 may similarly be essential for R. rickettsii's intracellular lifecycle and could potentially affect its virulence.

  • What experimental approaches are most effective for studying the translocation of RrIowa_0644 during infection?

    Investigating the potential translocation of RrIowa_0644 during infection requires specialized techniques similar to those used for studying other Rickettsia proteins:

    1. Cellular fractionation approaches:

      • Separate infected host cells into pellet (containing intact rickettsiae) and supernatant fractions

      • Use specific antibodies to detect RrIowa_0644 in different fractions

      • Include appropriate controls (e.g., GAPDH for host cytoplasm, EF-Ts for rickettsial cytoplasm, rOmpB for rickettsial outer membrane)

    2. Immunofluorescence microscopy:

      • Use confocal microscopy to visualize protein localization

      • Look for punctate structures in host cytoplasm outside of bacterial cells

      • Co-staining with markers for different host cell compartments

    3. Secretion pathway investigation:

      • Bioinformatic analysis to predict secretion signals

      • Investigation of non-classical secretion mechanisms (RrIowa_0644 likely lacks Sec-dependent signal peptides)

      • Analysis of potential processing/cleavage during translocation

    4. Biotinylation approaches:

      • Surface labeling of extracellular bacteria with thiol-cleavable sulfo-NHS-SS-biotin

      • Neutravidin affinity purification of labeled proteins

      • LC-MS/MS identification of surface-exposed proteins

    Studies with other Rickettsia proteins have shown that rickettsiae-associated proteins may have slightly slower mobility compared to those translocated into host cytoplasm, possibly due to cleavage of signal sequences during translocation . These methodological approaches provide a framework for investigating RrIowa_0644's potential role at the host-pathogen interface.

  • How might functional studies of RrIowa_0644 contribute to Rocky Mountain spotted fever vaccine development?

    Functional characterization of RrIowa_0644 could contribute to RMSF vaccine development through several research avenues:

    1. Antigen evaluation:

      • Assess immunogenicity of recombinant RrIowa_0644

      • Determine if antibodies against RrIowa_0644 are protective

      • Evaluate presence in naturally infected patients' sera

    2. Methodological approach for epitope mapping:

      • Generate peptide arrays covering the full sequence

      • Identify immunodominant regions

      • Test epitope conservation across R. rickettsii strains

    3. Functional interference studies:

      • Determine if antibodies against RrIowa_0644 can:

        • Block rickettsial adherence to host cells

        • Prevent phagosomal escape (similar to studies with Pat1/Pat2)

        • Inhibit intracellular growth

    4. Animal model validation:

      • Immunization studies with recombinant protein or peptides

      • Challenge with virulent R. rickettsii

      • Assessment of protection and immune correlates

    5. Strain variation analysis:

      • Compare RrIowa_0644 sequences across clinical isolates

      • Identify conserved regions for broadly protective responses

      • Evaluate cross-protection against related Rickettsia species

    If RrIowa_0644 proves to be surface-exposed and essential for bacterial viability or virulence, it could represent a valuable target for vaccine development. Experimental approaches should incorporate both humoral and cell-mediated immunity assessments, as both are likely important for protection against intracellular pathogens like R. rickettsii .

  • What methodologies can resolve contradictory data about RrIowa_0644's role in virulence differences between R. rickettsii strains?

    Resolving contradictory findings regarding RrIowa_0644's potential role in virulence differences between strains (e.g., Iowa vs. Sheila Smith) requires systematic approaches:

    1. Comprehensive comparative analysis:

      • Full sequence comparison of RrIowa_0644 across strains

      • Expression level quantification (RNA-seq, qRT-PCR)

      • Protein abundance measurement (quantitative proteomics)

    2. Genetic complementation experiments:

      • Swap RrIowa_0644 genes between strains

      • Create chimeric proteins with domains from different strains

      • Use controlled expression systems to normalize levels

    3. Host response characterization:

      • Compare IFN-β induction between strains (similar to studies showing Sheila Smith induces lower IFN-β compared to Iowa)

      • Measure downstream effects on STAT1/STAT2 phosphorylation

      • Evaluate expression of ISGs like TRAIL, IDO, and CXCL10

    4. Functional assays in multiple cell types:

      • Human dermal microvascular endothelial cells (HDMECs)

      • Various tick cell lines

      • Multiple animal model systems

    5. Multi-omics integration:

      • Integrate transcriptomics, proteomics, and functional data

      • Use systems biology approaches to identify networks affected

      • Create predictive models of strain-specific virulence mechanisms

    Research has shown significant differences in virulence between R. rickettsii strains, with Sheila Smith generally considered more virulent than Iowa. These differences manifest in delayed and reduced IFN-β secretion, differential activation of STAT proteins, and varied expression of interferon-stimulated genes . Investigating whether RrIowa_0644 contributes to these differences requires controlled experimental designs that can isolate its specific effects from other genetic differences between strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.