Recombinant Rickettsia rickettsii Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Gene Organization and Expression

The secF gene is part of a polycistronic operon in R. rickettsii that includes:

  • Upstream genes: nuoF (NADH dehydrogenase I chain F)

  • Downstream genes: lepB (signal peptidase I), rnc (RNase III) .

RT-PCR analyses confirm that secF is co-transcribed with nuoF, lepB, and rnc, suggesting coordinated regulation of protein export and metabolic functions .

Functional Role in Protein Translocation

SecF forms part of the SecDF-YajC subcomplex within the Sec translocase system, which:

  • Mediates post-translational translocation of secretory proteins.

  • Enhances the efficiency of preprotein movement through the SecYEG channel .

  • Cooperates with SecD to maintain proton motive force during export .

In R. rickettsii, this system is essential for surface-exposed protein (SEP) trafficking, including virulence factors like OmpA and OmpB .

Vaccine Development

While SecF itself is not a confirmed protective antigen, studies on related SEPs (e.g., Adr1, Adr2) highlight the potential of recombinant proteins in eliciting immune responses against R. rickettsii .

Comparative Insights

SecF homologs exist in other Rickettsia species (e.g., R. akari secF shares 94% sequence identity) but differ in critical residues affecting translocase assembly .

Limitations and Future Directions

  • Current studies focus on in vitro characterization; in vivo roles in pathogenesis remain underexplored.

  • Potential applications in high-throughput screening for Sec translocase inhibitors warrant investigation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
secF; A1G_00890; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Rickettsia rickettsii (strain Sheila Smith)
Target Names
secF
Target Protein Sequence
MQIYPLRLLPNKIDFDFMNFKKVSYTFSIILSLISFIWIGIYKFNFGIDFAGGIVIEVRL DQAPDLPKMRGVLGKLGIGEVVLQNFGSERDLSIRFGSNSEENLMKNIELIKGSLQSNFP YKFEYRKVDFVGPQVGRQLIEAGAMAMLFSFLAIMVYIWVRFEWYFGFGILIALVHDVIL ALGFMSMTKLDFNLSTIAAVLTIIGYSVNDSVVIYDRIRENLRKYHKKNITEIINLSINE TLSRTILTVITTLLANLALILFGGEAIRSFSILVFFGIIVGTYSSIFISAPILTMFVNRK FNKKVIER
Uniprot No.

Target Background

Function
This protein is part of the Sec protein translocase complex and interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Sec translocon system in Rickettsia rickettsii and what role does SecF play?

The Sec translocon system in Rickettsia rickettsii represents a fundamental protein secretion pathway that enables the translocation of proteins across bacterial membranes. Within this system, SecF functions as a critical component of the SecDF complex, which works in conjunction with the SecA ATPase and the SecYEG complex to enhance protein translocation efficiency .

The SecDF complex in bacteria is a proton-driven membrane protein that facilitates protein movement across the membrane after the initial translocation through SecYEG . This complex undergoes significant conformational changes during protein translocation, which are essential for its function. The SecF subunit contributes to the dynamic structural rearrangements, particularly in the periplasmic domains, that are necessary for efficient protein secretion .

In Rickettsia rickettsii specifically, the Sec-dependent secretion pathway is vital for exporting virulence factors and other proteins that enable the bacterium to establish infection and survive within host cells . The SecF protein represents one of the multiple components of this secretion machinery that collectively enable the pathogen's intracellular lifestyle.

What experimental systems are available for studying SecF function in Rickettsia?

Several experimental systems and methodologies have been developed for studying SecF and other Sec translocon components in Rickettsia species:

  • Heterologous Expression Systems: Using E. coli-based systems to express and study rickettsial proteins, particularly through complementation assays with temperature-sensitive E. coli mutants .

  • Alkaline Phosphatase (PhoA) Gene Fusion Systems: This approach has been successfully employed to assess the functionality of signal peptides in directing Sec-dependent protein secretion. Using the E. coli alkaline phosphatase (PhoA) as a reporter, researchers can determine whether predicted signal peptides from rickettsial proteins can direct Sec-dependent secretion .

  • Gene Expression Analysis: RT-PCR and other gene expression methods have been utilized to study the expression of Sec-dependent genes in Rickettsia during infection of mammalian cells . This helps identify which components of the secretion machinery are actively expressed during infection.

  • Rickettsial Cell Culture: Propagation of Rickettsia in mammalian cell lines (such as HeLa cells) under appropriate biosafety conditions allows for partial purification of rickettsial organisms for various analyses .

  • Bioinformatics Approaches: In silico analysis of rickettsial genomes has been used to predict proteins containing signal peptides that may be secreted through the Sec system .

What are the main challenges in producing recombinant SecF from Rickettsia rickettsii?

Producing recombinant SecF from Rickettsia rickettsii presents several significant challenges:

  • Obligate Intracellular Nature: Rickettsia rickettsii is an obligate intracellular bacterium that cannot be grown in cell-free media, making the isolation of native proteins technically challenging and requiring specialized containment facilities .

  • Membrane Protein Complexities: As SecF is a membrane protein, it presents inherent difficulties for recombinant expression, including proper membrane insertion, potential toxicity to heterologous hosts, and maintaining native conformation outside its natural membrane environment .

  • Species-Specific Functionality: As demonstrated with SecA proteins, there appears to be species specificity in the functionality of Sec translocon components . This suggests that recombinant SecF might not function properly in heterologous systems without modifications.

  • Biosafety Considerations: R. rickettsii is classified as a BSL-3 pathogen and R. prowazekii as a select agent by the U.S. government, necessitating specialized containment facilities and safety protocols for handling live organisms .

  • Protein Solubility and Stability: Membrane proteins like SecF often have solubility and stability issues when expressed recombinantly, requiring optimization of expression conditions, detergents, and purification protocols.

What is known about the gene expression patterns of secF in Rickettsia during infection cycles?

While the search results don't provide specific information about secF gene expression patterns in Rickettsia during infection cycles, some insights can be gained from related studies on Sec-dependent proteins in R. typhi:

Gene expression analysis of R. typhi during infection of HeLa cells has been performed to identify Sec-dependent proteins potentially involved in mammalian infections . Using two-step RT-PCR, researchers have examined the expression of genes encoding proteins with functional signal peptides.

For many intracellular pathogens, including Rickettsia, the expression of secretion system components is often regulated in response to environmental cues encountered during different stages of infection. The mammalian and arthropod host environments likely trigger differential expression of various components of the Sec machinery, including potentially secF .

The secA gene in R. rickettsii has been shown to be expressed monocistronically from a canonical prokaryotic promoter, with the transcriptional start point located 32 nucleotides upstream of the secA initiation codon . Given the functional relationship between different components of the Sec system, secF might follow similar expression patterns, though this would require specific experimental verification.

How do mutations in the secF gene affect protein secretion and virulence in Rickettsia rickettsii?

Mutations in the secF gene would likely have profound effects on protein secretion and virulence in Rickettsia rickettsii, though specific mutational studies on rickettsial secF are not directly addressed in the provided search results. Based on the known functions of SecDF in bacterial systems, we can infer the following potential impacts:

The SecDF complex enhances protein translocation across bacterial membranes by utilizing the proton motive force . Mutations affecting critical functional domains of SecF would potentially disrupt this enhancement, leading to inefficient protein secretion. The P1-head domain of SecDF undergoes significant conformational changes during protein translocation, and mutations affecting these conformational dynamics would likely impair SecDF function .

Given that the Sec system is responsible for the secretion of numerous virulence factors in pathogenic bacteria, impaired SecF function would likely result in reduced virulence. The exact magnitude of this effect would depend on which specific virulence factors are affected and their relative importance in pathogenesis.

Complementation studies with other Sec components have shown species specificity in functionality . This suggests that even conservative mutations might significantly impact SecF function due to the fine-tuned nature of these protein secretion systems.

A methodological approach to studying the effects of secF mutations would involve:

  • Site-directed mutagenesis of conserved residues in different domains of SecF

  • Complementation assays in model systems

  • Assessment of protein secretion efficiency using reporter systems

  • Virulence testing in appropriate cell culture or animal models

What is the interaction mechanism between SecF and other components of the Sec translocon machinery in Rickettsia?

The interaction mechanism between SecF and other components of the Sec translocon machinery in Rickettsia involves a complex, dynamic process:

SecDF functions by enhancing protein translocation initiated by the SecA ATPase and SecYEG complex . The current working model suggests that SecDF captures precursor proteins emerging from the SecYEG channel, with the P1-head domain playing a crucial role in this process .

The spatial arrangement between SecYEG and SecDF is critical for efficient translocation. It is proposed that the interacting cavity of the Super F form of SecDF at the periplasmic side would continue seamlessly from the exit of the SecYEG translocon, allowing precursor proteins to interact with the P1 cavity without delay .

SecDF is proposed to undergo a power stroke-like motion driven by the proton motive force, which helps pull precursor proteins through the SecYEG channel . This involves significant conformational changes, particularly in the P1-head domain, which cycles between different states (Super F, F, and I forms) .

Interactions with unfolded precursor proteins enhance the proton-transport activity of SecDF, suggesting a mechanism where substrate binding promotes conformational changes that facilitate proton translocation .

For methodological investigation of these interactions, techniques such as:

  • Cross-linking studies to capture transient protein-protein interactions

  • Single-molecule fluorescence measurements to track conformational changes

  • High-speed atomic force microscopy to observe dynamic structural changes in real-time

  • Co-immunoprecipitation assays to identify interaction partners

These approaches would provide valuable insights into the specific interactions between SecF and other components of the rickettsial Sec machinery.

How can structural data be used to design inhibitors targeting the SecF protein in Rickettsia rickettsii?

Structural data can be leveraged to design potential inhibitors targeting SecF in Rickettsia rickettsii through the following methodological approach:

Target Site Identification:
The critical functional regions of SecF, particularly those involved in conformational changes during the translocation process, represent prime targets for inhibitor design. The P1-head domain, which undergoes significant structural rearrangements and interacts with translocating polypeptides, would be a focal point for inhibitor development .

Structural Comparison and Specificity Analysis:
By comparing the structural features of rickettsial SecF with human host proteins, researchers can identify unique structural elements that could be targeted with high specificity. This comparative approach would minimize potential off-target effects in human cells.

Computational Screening and Molecular Docking:
Virtual screening of compound libraries against the identified target sites can identify candidate inhibitors with favorable binding properties. Molecular docking simulations can further refine these candidates and predict their binding modes and affinities.

Structure-Based Design Optimization:
Initial hit compounds can be optimized through iterative structure-based design, enhancing their binding affinity, specificity, and pharmacokinetic properties.

Assay Development for Functional Testing:
Developing in vitro assays to measure the impact of candidate compounds on SecF function, such as:

  • ATPase activity assays for the SecA-SecYEG-SecDF system

  • Protein translocation assays using fluorescently labeled substrates

  • Proton transport assays to measure SecDF proton-pumping activity

Validation in Cellular Systems:
Testing promising inhibitors in cellular infection models to assess their ability to reduce rickettsial growth and virulence.

Given the urgent need for new therapeutic options against rickettsial infections due to concerns about antibiotic resistance , targeting the essential Sec machinery represents a promising approach for drug development.

How does the proton-driven mechanism of SecDF in Rickettsia compare to that in model organisms like E. coli?

The proton-driven mechanism of SecDF in Rickettsia likely shares fundamental principles with that in model organisms like E. coli, though with species-specific adaptations:

SecDF in bacteria generally functions as a proton-driven protein that enhances protein translocation . This enhancement relies on conformational changes in the periplasmic domains, particularly the P1-head domain, which are coupled to proton translocation across the membrane .

The proton motive force is utilized by SecDF to drive conformational changes that assist in pulling precursor proteins through the SecYEG channel . In the proposed power stroke model, the P1-head domain changes its position and conformation in a cycle driven by proton translocation .

While the search results don't provide direct comparative data between rickettsial and E. coli SecDF, studies on SecA have shown that the full-length SecA proteins from R. rickettsii and R. typhi failed to functionally replace E. coli SecA, suggesting species-specific adaptations in the Sec machinery . Similar species-specific adaptations might exist in the SecDF complex.

The obligate intracellular lifestyle of Rickettsia likely imposes unique selective pressures on its secretion systems, potentially leading to adaptations in the proton-driven mechanism of SecDF. These adaptations might relate to the different pH environments encountered during the rickettsial life cycle or to specific substrates secreted by these pathogens.

Methodologically, comparative studies would benefit from:

  • Site-directed mutagenesis of conserved residues involved in proton translocation

  • Assessment of proton transport activities under varying pH conditions

  • Structural studies comparing the conformational states of rickettsial SecDF with those of E. coli

  • Chimeric protein approaches similar to those used with SecA

What methodological approaches are most effective for analyzing SecF-substrate interactions?

Several methodological approaches can be employed for analyzing SecF-substrate interactions in rickettsial systems:

Nuclear Magnetic Resonance (NMR) Spectroscopy: This technique is specifically mentioned in the search results as potentially valuable for analyzing interactions between substrate proteins and SecDF . NMR can provide atomic-level insights into the dynamics of protein-protein interactions, making it suitable for studying how SecF interacts with translocating polypeptides.

Cross-linking Combined with Mass Spectrometry: Chemical cross-linking can capture transient interactions between SecF and its substrates, with subsequent mass spectrometry analysis identifying interaction sites and the substrate proteins involved.

Site-Directed Mutagenesis and Functional Assays: Systematic mutation of residues in the proposed substrate-binding regions of SecF, followed by functional assays to assess the impact on protein translocation efficiency, can map the critical interaction sites.

Single-Molecule Fluorescence Resonance Energy Transfer (FRET): This approach can track the real-time dynamics of SecF-substrate interactions by labeling both SecF (or specific domains) and model substrate proteins with fluorescent probes.

Cryo-Electron Microscopy: Capturing SecF in complex with substrate proteins at different stages of translocation can provide structural insights into the interaction mechanism.

E. coli Alkaline Phosphatase (PhoA) Gene Fusion System: As demonstrated with signal peptide functionality assessment , this system could be adapted to study how different substrates interact with the Sec machinery, including SecF.

Computational Modeling and Molecular Dynamics Simulations: In silico approaches can complement experimental methods by predicting interaction mechanisms and dynamic changes during substrate translocation.

Given the technical challenges of working with rickettsial proteins, a combination of heterologous expression systems and in vitro reconstitution of purified components would likely provide the most practical approach for detailed interaction studies.

How should contradictory findings in SecF functional studies be evaluated and resolved?

When evaluating contradictory findings in SecF functional studies, researchers should employ a systematic approach:

Context-Dependent Functionality: One source of apparent contradictions may be the context-dependent functionality of SecF. For instance, complementation studies with rickettsial SecA in E. coli demonstrated that full-length proteins failed to function, while chimeric constructs succeeded . This suggests that contradictory findings might reflect genuine biological differences rather than experimental errors.

Methodological Differences Analysis: Create a comprehensive comparison table of experimental methods used in contradictory studies, focusing on:

  • Protein expression systems and tags

  • Purification methods

  • Assay conditions (pH, temperature, ionic strength)

  • Detection methods and their sensitivities

Methodological FactorStudy AStudy BPotential Impact on Results
Expression SystemE. coliInsect cellsFolding, post-translational modifications
Purification MethodDetergent-basedNative membraneProtein conformation, activity
Assay Temperature25°C37°CConformational dynamics, activity
Detection SensitivityWestern blotMass spectrometryDetection threshold, quantification accuracy

Statistical Rigor Assessment: Evaluate the statistical methods used in contradictory studies, including:

  • Sample sizes and power calculations

  • Statistical tests and their appropriateness

  • P-value thresholds and multiple testing corrections

  • Effect size calculations

Replication Studies: Design experiments that specifically address the contradictions by:

  • Using multiple complementary methodologies

  • Varying critical parameters systematically

  • Including appropriate controls for each variable

  • Collaborating with laboratories reporting contradictory findings

Biological Variability Considerations: Assess whether apparent contradictions might reflect genuine biological variability in:

  • Strain differences within Rickettsia rickettsii

  • Growth conditions affecting protein expression

  • Host cell effects on bacterial physiology

Resolution of contradictions should be approached as an opportunity to gain deeper insights into the complex and context-dependent functions of the SecF protein.

What statistical approaches are most appropriate for analyzing SecF expression data from different rickettsial life stages?

When analyzing SecF expression data across different rickettsial life stages, researchers should consider these statistical approaches:

Normalization Strategies for Time-Series Data:

  • Global normalization methods (RPKM, TPM) for RNA-seq data

  • Use of multiple reference genes for RT-qPCR data that remain stable across life stages

  • Spike-in controls to account for varying total RNA amounts across stages

Appropriate Statistical Methods for Time-Series Analysis:

  • Linear mixed-effects models to account for repeated measurements and random effects

  • Time-series analysis methods such as autocorrelation functions and spectral analysis

  • ANOVA with post-hoc testing for multi-stage comparisons with correction for multiple testing

Sample Size and Power Calculations:
The minimum sample size required can be calculated using:
n=2(Zα/2+Zβ)2σ2Δ2n = \frac{2(Z_{\alpha/2} + Z_{\beta})^2\sigma^2}{\Delta^2}
Where:

  • Zα/2Z_{\alpha/2} and ZβZ_{\beta} are standard normal deviates for significance level and power

  • σ2\sigma^2 is the estimated variance

  • Δ\Delta is the minimum biologically significant difference to detect

Handling Biological and Technical Replicates:

  • Nested design analysis to separate biological from technical variability

  • Intraclass correlation coefficients to assess reproducibility

Multiple Testing Correction Methods:

  • Benjamini-Hochberg procedure for controlling false discovery rate

  • Bonferroni correction for stringent family-wise error rate control

  • q-value approach for genomic data analysis

Visualization Techniques:

  • Heat maps with hierarchical clustering for pattern identification

  • Principal component analysis for dimensionality reduction and stage separation

  • Violin plots to visualize distribution changes across stages

Integrative Analysis Approaches:

  • Correlation analysis between SecF expression and other Sec components

  • Pathway enrichment analysis to contextualize SecF expression changes

  • Network analysis to identify co-regulated genes

These approaches should be selected based on the specific experimental design, sample availability, and the biological questions being addressed.

How can researchers differentiate between sequence variations that affect SecF function and those that are neutral?

Differentiating between functional and neutral sequence variations in the SecF protein requires a multi-faceted approach:

Evolutionary Conservation Analysis:

  • Multiple sequence alignment of SecF sequences across diverse bacterial species

  • Calculation of conservation scores for each amino acid position

  • Identification of absolutely conserved residues, which likely serve critical functions

  • Calculation of site-specific evolutionary rates using methods like Rate4Site

Structure-Function Relationship Mapping:

  • Mapping sequence variations onto available structural models of SecF

  • Identifying variations that occur in:

    • Functionally annotated domains (e.g., P1-head domain)

    • Transmembrane regions critical for proton translocation

    • Predicted substrate binding sites

    • Regions of conformational flexibility

Predictive Computational Tools:

  • SIFT (Sorting Intolerant From Tolerant) scores

  • PolyPhen-2 predictions for potentially damaging substitutions

  • PROVEAN (Protein Variation Effect Analyzer) scores

  • Consurf server for structure-based conservation analysis

Experimental Validation Approaches:

  • Site-directed mutagenesis of selected variants

  • Functional complementation assays in model systems

  • In vitro protein translocation assays with purified components

  • Proton translocation measurements for variants

  • Protein stability and folding assessments

Decision Matrix for Variant Classification:

CriterionLikely FunctionalPossibly FunctionalLikely Neutral
Conservation>90% conserved50-90% conserved<50% conserved
StructureActive site/interfaceSurface exposedBuried, non-functional
PhysiochemicalMajor changeModerate changeConservative change
Predicted ImpactSIFT <0.05, PolyPhen >0.9Intermediate scoresSIFT >0.5, PolyPhen <0.2
ExperimentalAbolishes functionReduces functionMaintains function

Using this integrated approach allows researchers to prioritize variations for detailed functional studies and to interpret naturally occurring variations in rickettsial populations.

What are the key considerations for analyzing data from SecF inhibition experiments?

When analyzing data from SecF inhibition experiments, researchers should consider several key factors:

Dose-Response Relationship Assessment:

  • Establish full dose-response curves with appropriate concentration ranges

  • Calculate IC50 values (concentration causing 50% inhibition) with confidence intervals

  • Evaluate Hill coefficients to assess cooperativity in inhibition mechanism

  • Consider time-dependency of inhibition effects

Specificity Controls:

  • Test inhibitors against related proteins (e.g., SecD) to assess selectivity

  • Include structurally similar but inactive compounds as negative controls

  • Evaluate effects on other membrane proteins to rule out non-specific membrane disruption

  • Test against host cell proteins to assess potential toxicity

Mechanism of Action Studies:

  • Distinguish between competitive, non-competitive, and uncompetitive inhibition

  • Analyze effects on ATPase activity, protein translocation, and proton transport separately

  • Evaluate reversibility of inhibition through washout experiments

  • Consider covalent vs. non-covalent binding mechanisms

Cellular Context Evaluation:

  • Compare in vitro inhibition with effects in cellular infection models

  • Assess impact on secretion of known Sec-dependent virulence factors

  • Measure effects on bacterial survival and replication in host cells

  • Evaluate potential for resistance development

Statistical Analysis Approaches:

  • Use appropriate regression models for dose-response curve fitting

  • Employ ANOVA or mixed-effects models for multi-condition comparisons

  • Calculate effect sizes and their confidence intervals

  • Consider hierarchical Bayesian approaches for integrating multiple data types

Potential Confounding Factors:

  • Compound solubility and stability in assay conditions

  • Non-specific binding to assay components

  • Assay interference through absorbance, fluorescence, or redox activity

  • Off-target effects on bacterial physiology

A sample data analysis framework is presented below:

Analysis StepKey MethodsOutput MetricsInterpretation Guidelines
Primary ScreeningZ'-factor calculation, % inhibitionHit identification thresholdZ' > 0.5 indicates robust assay
Dose-Response4-parameter logistic regressionIC50, Hill slopeLower IC50 indicates higher potency
SelectivitySelectivity index calculationSI = IC50(off-target)/IC50(SecF)SI > 10 suggests selective inhibition
MOA StudiesEnzyme kinetics, binding studiesKi, koff, residence timeCompetitive vs. allosteric mechanisms
Cellular ActivityBacterial load quantificationEC50, minimum inhibitory concentrationTranslation of biochemical to cellular activity

How should researchers interpret conflicting results between in vitro and in vivo studies of SecF function?

When interpreting conflicting results between in vitro and in vivo studies of SecF function, researchers should consider:

Fundamental Differences Between Systems:
In vitro studies typically involve purified components in simplified environments, while in vivo studies capture the full complexity of biological systems. The obligate intracellular nature of Rickettsia adds another layer of complexity to in vivo studies . A systematic comparison of the experimental conditions is essential:

ParameterIn Vitro SystemsIn Vivo SystemsPotential Impact
Protein ConcentrationOften higher than physiologicalPhysiological levelsAltered reaction kinetics, aggregation
Interaction PartnersLimited, defined componentsComplete proteomeMissing cofactors, regulatory interactions
Membrane EnvironmentDetergents or artificial lipidsNative membranesAltered protein conformation and dynamics
Spatiotemporal RegulationAbsentPresentMissing localization effects, temporal control
Post-translational ModificationsUsually absentPresentAltered activity, interactions

Resolution Strategies:

  • Bridge Studies: Develop intermediate complexity systems (e.g., membrane vesicles, spheroplasts) to bridge the gap between fully purified and cellular systems.

  • Comparative Analysis Framework:

    • Identify specific parameters that differ between systems

    • Systematically vary these parameters in controlled experiments

    • Determine which conditions reproduce the conflicting results

  • Integrated Data Analysis:

    • Develop mathematical models that incorporate both in vitro kinetic parameters and in vivo constraints

    • Use Bayesian approaches to update model parameters based on both data types

    • Identify parameter sets that can explain both types of observations

  • Improved In Vitro Systems:

    • Reconstitute SecF in nanodiscs or liposomes with native-like lipid composition

    • Include additional components of the Sec machinery that might be missing

    • Recreate physiological conditions (pH, ionic strength, molecular crowding)

  • More Controlled In Vivo Studies:

    • Develop inducible expression systems for mutant analysis

    • Use microscopy techniques to track protein localization and dynamics

    • Employ selective inhibitors to dissect specific functions

Interpreting Validation Outcomes:

  • If conflicts persist despite bridging studies, consider fundamental biological aspects not captured in simplified systems

  • If conflicts are resolved by specific parameters, these parameters likely represent critical aspects of SecF function

  • If in vitro data consistently fails to predict in vivo outcomes, re-evaluate the relevance of the in vitro model

What are the optimal conditions for expressing recombinant Rickettsia rickettsii SecF protein?

Optimal conditions for expressing recombinant Rickettsia rickettsii SecF protein require careful consideration of multiple factors:

Expression System Selection:
Based on experiences with other rickettsial proteins, several expression systems could be considered:

Expression SystemAdvantagesDisadvantagesRecommendations
E. coliHigh yield, cost-effectivePotential toxicity, inclusion bodiesC41(DE3) or C43(DE3) strains designed for membrane proteins
Insect cellsBetter folding, post-translational modificationsLower yield, more expensiveSf9 or High Five cells with baculovirus vectors
Cell-free systemsAvoids toxicity issues, rapidLower yield for membrane proteinsE. coli S30 extract supplemented with lipids/detergents

Vector Design Considerations:

  • Fusion tags: His6 for purification, potentially with MBP or SUMO for solubility enhancement

  • Codon optimization for the expression host

  • Inducible promoters with tight regulation (e.g., T7-lac or tet-inducible)

  • Signal sequences optimization or replacement if needed

Induction and Growth Conditions:

  • Temperature: Lower temperatures (16-25°C) often improve membrane protein folding

  • Induction timing: Mid-log phase (OD600 ~0.6-0.8)

  • Inducer concentration: Typically lower concentrations for membrane proteins

  • Media supplements: Consider addition of glycerol (0.4-0.6%) and specific ions

Membrane Extraction and Protein Purification:

  • Detergent screening: Test multiple detergents (DDM, LMNG, GDN) for efficient extraction

  • Purification strategy: IMAC followed by size exclusion chromatography

  • Buffer optimization: Include glycerol and reducing agents to maintain stability

Protein Quality Assessment:

  • Size exclusion chromatography to assess monodispersity

  • Circular dichroism for secondary structure analysis

  • Functional assays to confirm activity of the purified protein

For methodological optimization, a fractional factorial design approach is recommended to efficiently test multiple conditions simultaneously and identify optimal expression parameters.

What are the most reliable methods for assessing SecF-dependent protein secretion in Rickettsia?

Given the challenges of working with obligate intracellular Rickettsia, several complementary approaches should be employed to reliably assess SecF-dependent protein secretion:

Reporter Protein Systems:
The E. coli alkaline phosphatase (PhoA) gene fusion system has been successfully applied to study Sec-dependent signal peptides from R. typhi . This system can be adapted to assess SecF dependency by comparing secretion efficiency in SecF-depleted or inhibited conditions. Other potential reporter systems include:

  • β-lactamase fusions

  • Fluorescent protein fusions with appropriate folding properties

  • Split GFP complementation assays

Proteomic Approaches:

  • Comparative secretome analysis: Compare the profile of secreted proteins in normal vs. SecF-depleted conditions using mass spectrometry

  • SILAC or TMT labeling for quantitative comparison

  • Detection of specific Sec-dependent proteins using targeted proteomics (PRM/MRM)

Microscopy-Based Techniques:

  • Immunofluorescence to track localization of known Sec-dependent proteins

  • Super-resolution microscopy to visualize SecF-substrate interactions

  • Electron microscopy to assess ultrastructural changes in secretion-deficient conditions

Genetic and Molecular Approaches:

  • Construction of conditional SecF depletion strains

  • CRISPR interference to downregulate SecF expression

  • Site-directed mutagenesis of key SecF residues with subsequent assessment of secretion phenotypes

Biochemical Assays:

  • In vitro protein translocation assays using inverted membrane vesicles

  • ATPase activity measurements to assess SecA-dependent translocation

  • Proton transport measurements to assess SecDF functionality

A multi-method validation approach is recommended, as illustrated in the following workflow:

  • Initial screening with reporter protein systems

  • Confirmation with proteomic profiling of multiple potential substrates

  • Detailed analysis of specific substrates using microscopy and biochemical approaches

  • Genetic validation through conditional expression/depletion studies

This integrated approach provides multiple lines of evidence for SecF-dependent secretion while minimizing potential artifacts from any single method.

How can researchers effectively study the conformational changes of SecF during protein translocation?

Studying the dynamic conformational changes of SecF during protein translocation requires sophisticated biophysical and structural biology approaches:

Single-Molecule Fluorescence Techniques:

  • Single-molecule FRET (smFRET) to track distance changes between labeled domains

  • Fluorescence quenching to monitor accessibility changes during conformational shifts

  • Single-molecule tracking to observe SecF dynamics in native membranes

High-Speed Atomic Force Microscopy (HS-AFM):
This technique is specifically mentioned in the search results as suitable for observing the dynamics of P1 motion in SecDF . HS-AFM can directly visualize conformational changes of membrane proteins with sub-nanometer resolution and sub-second temporal resolution.

Time-Resolved Structural Methods:

  • Time-resolved cryo-EM to capture different conformational states

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions with changing solvent accessibility

  • XFEL (X-ray free-electron laser) crystallography for capturing transient states

Computational Approaches:

  • Molecular dynamics simulations to model conformational transitions

  • Normal mode analysis to identify intrinsic conformational flexibility

  • Markov state modeling to predict conformational pathways

Experimental Design Considerations:

  • Conformational Trapping: Use nucleotide analogs, substrate mimics, or specific inhibitors to trap SecF in different conformational states

  • Site-Specific Probes: Strategic placement of fluorescent labels or spin labels at key regions predicted to undergo conformational changes

  • Real-Time Measurements: Synchronize measurements with translocation events using triggered mixing or photocleavable substrates

Integrated Analysis Framework:
A systematic approach combining multiple techniques provides the most comprehensive view:

TechniqueInformation ProvidedTemporal ResolutionSpatial Resolution
smFRETDistance changes between specific residuesMillisecondsAngstroms (pairs)
HS-AFMSurface topology changesSub-secondsSub-nanometer
HDX-MSSolvent accessibility changesSeconds to minutesPeptide segments
Cryo-EM3D structural snapshotsStatic (multiple states)Near-atomic
MD SimulationsAtomic motions, energy landscapesNanosecondsAtomic

By integrating these methods, researchers can reconstruct the sequence and mechanism of conformational changes during SecF-mediated protein translocation.

What controls are essential for validating specificity in SecF inhibition studies?

To establish the specificity and validity of SecF inhibition studies, a comprehensive set of controls is essential:

Target Validation Controls:

  • Genetic Controls:

    • SecF-depleted or knockout strains (where viable) should phenocopy inhibitor effects

    • SecF overexpression should increase the inhibitor concentration needed for effect

    • Point mutations in predicted inhibitor binding sites should confer resistance

  • Molecular Controls:

    • Inactive structural analogs of the inhibitor should show no effect

    • Structurally distinct inhibitors targeting the same site should show similar effects

    • Dose-response relationships should be consistent with specific binding

Specificity Controls:

  • Related Protein Controls:

    • Test effects on closely related proteins (SecD, YajC)

    • Assess impact on other bacterial secretion systems (Type I-VI)

    • Evaluate effects on the ATPase activity of SecA separately

  • Off-Target Effect Controls:

    • Membrane integrity assays to rule out non-specific membrane disruption

    • Global protein synthesis measurements to exclude translation inhibition

    • ATP levels monitoring to rule out energy depletion effects

Functional Validation Controls:

  • Pathway-Specific Readouts:

    • Compare effects on Sec-dependent vs. Sec-independent protein secretion

    • Assess specific steps in translocation (SecA binding, ATP hydrolysis, protein movement)

    • Evaluate proton translocation function of SecDF specifically

  • Resistance Development:

    • Passage bacteria in sub-inhibitory concentrations and sequence for mutations

    • Express SecF variants with known mutations and test inhibitor sensitivity

Experimental Design Controls:

  • Assay Validation:

    • Include positive controls (known inhibitors of bacterial growth or secretion)

    • Vehicle controls (solvent used for inhibitor delivery)

    • Assay quality metrics (Z', signal-to-background ratio)

  • Data Analysis:

    • Test multiple independently synthesized batches of the inhibitor

    • Blinded experimental design and analysis where possible

    • Appropriate statistical analysis with multiple biological replicates

A comprehensive control matrix for SecF inhibition studies might include:

Control TypePurposeExpected ResultInterpretation if Failed
SecF knockout + inhibitorTarget validationNo additional effectOff-target activity
SecF point mutantBinding site validationReduced inhibitor sensitivityIncorrect binding model
Inactive analogChemical specificityNo inhibitionStructure-activity relationship unclear
Membrane permeabilityOff-target exclusionNo membrane disruptionNon-specific membrane effects
Sec-independent proteinPathway specificityUnaffected secretionGeneral secretion inhibition
Host cell proteinsTherapeutic windowMinimal effect on hostPotential toxicity concerns

What are the key considerations for designing in vivo experiments to study SecF function in Rickettsia infection models?

Designing in vivo experiments to study SecF function in Rickettsia infection models requires careful consideration of multiple factors:

Biosafety Considerations:

  • R. rickettsii is classified as a BSL-3 pathogen, requiring appropriate containment facilities and safety protocols

  • All experimental designs must comply with institutional biosafety regulations and appropriate national guidelines

Model System Selection:

  • Cell Culture Models: HeLa cells have been used for propagating rickettsiae , but additional cell types relevant to infection (endothelial cells, macrophages) should be considered

  • Animal Models: For in vivo studies, appropriate animal models include guinea pigs, which develop disease similar to humans

  • Arthropod Vector Models: Considering the natural tick vector for studying transmission aspects

Genetic Manipulation Strategies:

  • Conditional Expression Systems: Tetracycline-inducible or similar systems to control SecF expression

  • Antisense RNA Approaches: For targeted knockdown of SecF expression

  • Site-Directed Mutagenesis: To study specific functional domains

  • Reporter Fusions: Fluorescent or enzymatic tags to track SecF localization and expression

Infection Parameters Standardization:

  • Defined multiplicity of infection (MOI)

  • Standardized infection protocols and timing

  • Quantitative measurement of bacterial attachment, entry, and replication

Readout Selection:

  • Bacterial Growth: qPCR-based quantification of rickettsial load

  • Host Response: Cytokine profiles, cell death assays, transcriptomics

  • Protein Secretion: Detection of known Sec-dependent rickettsial proteins

  • Virulence Assessment: Pathological changes in tissues, clinical scoring in animal models

Experimental Design Framework:
A comprehensive experimental design should include:

  • Temporal Analysis:

    • Early (attachment/entry)

    • Mid (establishment of intracellular niche)

    • Late (replication/spread) time points

  • Comparative Analysis:

    • Wild-type vs. SecF-modified Rickettsia

    • Different host cell types or tissues

    • Varied environmental conditions (pH, temperature, nutrient availability)

  • Intervention Studies:

    • Pre-treatment vs. post-infection treatment with potential inhibitors

    • Dose-response relationships and timing optimization

    • Combination approaches with other targets

  • Controls and Validation:

    • Complementation studies to confirm phenotype specificity

    • Parallel in vitro studies to link molecular mechanisms to in vivo observations

    • Appropriate statistical power calculations for animal studies

By integrating these considerations, researchers can design rigorous experiments that effectively elucidate the role of SecF in Rickettsia pathogenesis while adhering to necessary safety standards and ethical considerations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.