Recombinant Rickettsia typhi CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA)

Shipped with Ice Packs
In Stock

Description

Functional Role in R. typhi Metabolism

PgsA is part of the phospholipid biosynthesis pathway, which is critical for:

  • Membrane Biogenesis: Synthesizes phosphatidylglycerol (PG), a major component of R. typhi’s inner membrane .

  • Host Adaptation: Rickettsiae lack glycolysis and rely on host-derived metabolites (e.g., glycerol-3-phosphate) to fuel lipid biosynthesis .

  • Pathogen Survival: Membrane lipids facilitate intracellular survival by resisting host antimicrobial responses .

3.1. Mechanistic Studies

Recombinant PgsA is used to:

  • Characterize enzymatic kinetics and substrate specificity (e.g., CDP-diacylglycerol binding) .

  • Study inhibitors targeting rickettsial lipid metabolism, a potential therapeutic avenue .

3.2. Vaccine Development

While not directly tested as a vaccine antigen, related rickettsial enzymes (e.g., Pat1 phospholipase) have been explored for vaccine candidates. PgsA’s role in membrane integrity makes it a plausible target for attenuated strains .

Comparative Analysis with Homologs

SpeciesProteinUniProt IDLengthKey Differences
Rickettsia typhiPgsAQ68XS5178 aaTyphus group-specific; expressed in E. coli
Rickettsia belliiPgsAQ1RKM3181 aaBroader substrate range; 94% sequence identity
HumanPutative PgsA1P63753209 aaEukaryotic homolog with divergent active site

Research Gaps and Future Directions

  • Functional Redundancy: R. typhi possesses multiple phospholipid biosynthesis enzymes (e.g., Pat1/Pat2 phospholipases), but PgsA’s interaction with these remains unstudied .

  • Host-Pathogen Dynamics: How host-derived glycerol-3-phosphate availability impacts PgsA activity during infection is unclear .

  • Therapeutic Potential: No inhibitors targeting PgsA have been reported, unlike phospholipases (e.g., PLA2) validated as virulence factors .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are sent with standard blue ice packs. If dry ice packaging is preferred, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, and customers may use this as a reference point.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
pgsA; RT0081; CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Target Names
pgsA
Target Protein Sequence
MKNLPNYLTIARIMVIPVIILLFYINNSLARKLGALLFVLASITDFFDGYIARKYNLVTS FGKMFDPIADKLLVGCVTIMLLKKDNVDEIPCLLILAREFLVSGLREFLALVKVSVPVSR LAKLKTFLQMFALSILILGSKGSGIIYLDIVGEIILWIAAFLTIITGYSYFKACKTYF
Uniprot No.

Target Background

Function
This protein is responsible for catalyzing the committed step in the biosynthesis of acidic phospholipids.
Database Links

KEGG: rty:RT0081

STRING: 257363.RT0081

Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of pgsA in Rickettsia typhi?

CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA) in R. typhi is a membrane enzyme that catalyzes a critical step in phospholipid biosynthesis, specifically the formation of phosphatidylglycerophosphate from CDP-diacylglycerol and glycerol-3-phosphate. This reaction is essential for the subsequent synthesis of phosphatidylglycerol, a major component of bacterial membranes. As an obligate intracellular bacterium, R. typhi relies on intact membrane biogenesis pathways for survival, making pgsA an important enzyme for bacterial viability and potentially a target for therapeutic development.

Gene sequence analysis from the complete genome of R. typhi reveals pgsA has the locus tag RT0081 and encodes a protein with an approximate size consistent with other bacterial phosphatidyltransferases . The enzyme contributes to the maintenance of the Gram-negative cell envelope, which in R. typhi includes both peptidoglycan and lipopolysaccharide components .

What are the optimal expression systems for recombinant R. typhi pgsA?

Expression of recombinant R. typhi pgsA presents challenges due to its membrane-associated nature and potential toxicity to host cells. The most successful approach employs E. coli expression systems with tightly regulated promoters to control expression levels. For research applications, the pSY5 plasmid system has been demonstrated effective for expression of rickettsial recombinant proteins .

Methodology for optimal expression includes:

  • Gene optimization: Codon optimization for E. coli expression while maintaining the native protein sequence

  • Expression construct design: Inclusion of affinity tags (His6 or GST) for purification

  • Host strain selection: E. coli strains with reduced proteolytic activity (BL21(DE3) or derivatives)

  • Induction conditions: Low temperature (16-20°C) induction for 16-20 hours using reduced IPTG concentrations (0.1-0.5 mM)

  • Membrane fraction isolation: Careful lysis and differential centrifugation to isolate membrane fractions containing the expressed protein

Expression yields are typically modest due to the membrane protein nature, with careful optimization required for each preparation.

What purification strategy yields the highest activity for recombinant pgsA?

Purification of functionally active recombinant pgsA requires careful solubilization and chromatographic steps to maintain the native conformation. The most effective purification protocol involves:

  • Membrane preparation: Isolation of bacterial membranes by ultracentrifugation following cell disruption

  • Detergent solubilization: Gentle solubilization using mild detergents (n-dodecyl-β-D-maltoside or CHAPS at 1-2%) for 1-2 hours at 4°C

  • Affinity chromatography: IMAC (Immobilized Metal Affinity Chromatography) for His-tagged constructs

  • Size exclusion chromatography: Final purification step to remove aggregates and obtain homogeneous protein preparation

  • Detergent exchange: If required, exchange to detergents suitable for downstream applications

The purified protein should be stored in 50% glycerol Tris-based buffer at -20°C for short-term storage or -80°C for extended storage, avoiding repeated freeze-thaw cycles . Activity assays should be performed immediately after purification to confirm functional integrity.

How does the structure of R. typhi pgsA differ from other bacterial phosphatidyltransferases?

R. typhi pgsA maintains the core structural features common to bacterial phosphatidyltransferases but exhibits specific adaptations related to its intracellular lifestyle. Structural predictions based on sequence analysis indicate:

  • Transmembrane topology: Contains multiple transmembrane helices forming a catalytic pocket accessible from the cytoplasmic face

  • Conserved catalytic residues: Maintains the CDP-alcohol phosphatidyltransferase motif essential for activity

  • Unique features: Contains R. typhi-specific amino acid substitutions in the substrate-binding regions

These structural differences may reflect adaptation to the unique phospholipid composition requirements of rickettsial membranes or adaptations to the intracellular environment. Unlike free-living bacteria, R. typhi exists in the eukaryotic cytosol, potentially exposing its membrane proteins to host cell immune receptors that recognize bacterial cell envelope components .

What enzymatic activity assays are appropriate for characterizing recombinant pgsA?

Functional characterization of recombinant pgsA requires specialized assays to measure its phosphatidyltransferase activity. The most reliable methodologies include:

  • Radiometric assay: Measuring incorporation of radiolabeled substrates (typically 14C-glycerol-3-phosphate) into phosphatidylglycerophosphate

  • Coupled enzyme assay: Monitoring release of CMP as a product of the reaction using coupled enzymatic reactions

  • Mass spectrometry-based assay: Detecting product formation using LC-MS/MS to identify and quantify specific phospholipid species

A typical activity assay contains:

  • 50 mM HEPES buffer (pH 7.5)

  • 50 mM KCl

  • 10 mM MgCl2

  • 0.1% appropriate detergent

  • 50-100 μM CDP-diacylglycerol

  • 50-100 μM glycerol-3-phosphate

  • 1-5 μg purified enzyme

Reaction products can be analyzed after lipid extraction using thin-layer chromatography or liquid chromatography coupled with mass spectrometry, similar to approaches used for analyzing peptidoglycan components from R. typhi .

How can recombinant pgsA contribute to understanding Rickettsia pathogenesis?

Recombinant pgsA serves as a valuable tool for investigating several aspects of rickettsial pathogenesis:

  • Membrane biogenesis: As a key enzyme in phospholipid biosynthesis, pgsA studies provide insights into how rickettsiae maintain membrane integrity during infection

  • Drug target identification: Structural and functional analysis of pgsA can identify potential inhibitors that may disrupt rickettsial membrane synthesis

  • Host-pathogen interactions: Investigation of how rickettsial membrane components interact with host cell receptors, potentially revealing mechanisms of immune evasion

Research approaches utilizing recombinant pgsA include:

  • Inhibitor screening assays to identify compounds that specifically target rickettsial phospholipid biosynthesis

  • Site-directed mutagenesis to determine essential residues for function

  • Interaction studies with host cell components to understand membrane-related virulence mechanisms

These approaches complement broader studies of rickettsial membrane components, including peptidoglycan and lipopolysaccharide, which have been implicated in host immune recognition .

What role does pgsA play in developing diagnostic tools for rickettsial diseases?

While not typically used directly as a diagnostic antigen, recombinant pgsA research contributes to rickettsial disease diagnostics through:

  • Understanding membrane composition: Insights into phospholipid biosynthesis inform the development of membrane-based diagnostic antigens

  • Recombinant protein technology: Methods developed for pgsA expression can be applied to other rickettsial proteins with direct diagnostic utility

  • Structure-based design: Knowledge of membrane protein structure facilitates rational design of diagnostic reagents

Current diagnostic approaches for rickettsial diseases include ELISA methods using recombinant outer membrane proteins (OmpA and OmpB), which have shown promise as alternatives to traditional immunofluorescence assay (IFA) methods . The recombinant protein ELISA approach requires only BSL-2 facilities rather than the specialized BSL-3 facilities needed for whole-organism antigen preparation, making diagnostics more accessible in low-resource settings .

How does pgsA expression vary under different growth conditions and during infection?

The expression patterns of pgsA during rickettsial infection remain incompletely characterized due to the technical challenges of studying obligate intracellular pathogens. Advanced research approaches include:

  • Transcriptomic analysis: RNA-seq of R. typhi during different stages of infection to track pgsA expression

  • Reporter systems: Development of fluorescent reporters linked to the pgsA promoter in recombinant R. typhi, building on established transformation methods like those used for GFPuv expression

  • Proteomics: Quantitative proteomic analysis of membrane fractions during infection

Preliminary data suggest phospholipid biosynthesis enzyme expression may be regulated in response to host cell conditions, potentially as an adaptation mechanism. GFPuv-expressing recombinant R. typhi systems provide a foundation for developing similar tools to monitor pgsA expression dynamics in vitro and in vivo .

Can structural modifications of pgsA enhance its stability for crystallization studies?

Obtaining crystal structures of membrane proteins like pgsA presents significant challenges. Advanced approaches to enhance stability for structural studies include:

  • Truncation constructs: Removal of flexible regions while maintaining the catalytic core

  • Fusion partners: Addition of crystallization chaperones (T4 lysozyme, BRIL) to stabilize the protein

  • Thermostabilizing mutations: Introduction of disulfide bonds or surface mutations to enhance thermostability

  • Nanobody co-crystallization: Development of nanobodies that stabilize specific conformations

  • Lipidic cubic phase crystallization: Specialized membrane protein crystallization techniques

These approaches have not yet been successfully applied to R. typhi pgsA specifically but represent frontier research directions for understanding rickettsial membrane protein structure. Alternative structural determination methods including cryo-electron microscopy may be particularly suitable for membrane proteins like pgsA that resist crystallization.

What are the major challenges in working with recombinant R. typhi proteins and how can they be overcome?

Research with recombinant R. typhi proteins presents several technical challenges:

  • Growth conditions: As obligate intracellular bacteria, cultivation of R. typhi requires specialized cell culture systems, limiting biomass production

  • Biosafety requirements: Work with live R. typhi requires BSL-3 containment facilities

  • Membrane protein expression: Recombinant expression of membrane proteins often results in toxicity or misfolding

Methodological solutions include:

  • Recombinant protein expression in E. coli using optimized expression vectors like pSY5

  • Development of transformation systems for R. typhi, as demonstrated with the pRAM18dRGA plasmid

  • Cell-free protein synthesis systems for toxic proteins

  • Use of Vero cell culture systems for propagation of transformed rickettsiae

These approaches have enabled significant advances, including the production of recombinant outer membrane proteins (OmpA, OmpB) for diagnostic applications and the development of GFPuv-expressing R. typhi for infection studies .

How can researchers optimize yield and purity of recombinant pgsA for structural studies?

Obtaining sufficient quantities of pure, active pgsA for structural studies requires specialized approaches:

  • Expression optimization:

    • Testing multiple E. coli strains (C41(DE3), C43(DE3)) specifically designed for membrane protein expression

    • Evaluation of different fusion tags (MBP, SUMO) to enhance solubility

    • Temperature and induction condition screening (16-30°C, 0.1-1.0 mM IPTG)

  • Purification enhancement:

    • Systematic detergent screening (DDM, LMNG, GDN) for optimal solubilization

    • Implementation of orthogonal purification techniques (ion exchange, hydrophobic interaction chromatography)

    • Lipid supplementation during purification to maintain stability

  • Stability assessment:

    • Thermal shift assays to identify stabilizing buffer conditions

    • SEC-MALS analysis to verify monodispersity

    • Activity measurements following each purification step to track functional integrity

These optimizations require iterative testing and validation, with successful approaches potentially applicable to other challenging rickettsial membrane proteins.

What emerging technologies might advance our understanding of pgsA function in rickettsial biology?

Several cutting-edge technologies show promise for expanding our understanding of pgsA and rickettsial membrane biogenesis:

  • CRISPR interference systems adapted for rickettsial species

  • Single-cell analysis of infected host cells to track membrane lipid composition changes

  • Advanced lipidomics to characterize phospholipid profiles during infection

  • Cryo-electron tomography of rickettsial membranes during different infection stages

  • In situ structural biology approaches using focused ion beam milling and cryo-electron tomography

These technologies could help address fundamental questions about how rickettsiae modify their membranes during infection and how phospholipid composition contributes to pathogenesis and immune evasion. The development of GFPuv-expressing recombinant R. typhi has already demonstrated the feasibility of genetic manipulation in this organism , potentially paving the way for more sophisticated genetic studies of phospholipid biosynthesis.

How might inhibition of pgsA contribute to novel therapeutic approaches against rickettsial infections?

Targeting phospholipid biosynthesis represents a promising but underexplored therapeutic strategy against rickettsial infections. Future research directions include:

  • Structure-based drug design targeting R. typhi pgsA

  • High-throughput screening of compound libraries against recombinant pgsA

  • Evaluation of synergistic effects between phospholipid biosynthesis inhibitors and current antibiotics

  • Development of nanoparticle-based delivery systems for pgsA inhibitors

The limited metabolic capabilities of rickettsiae due to their reduced genome (1,111,496 bp encoding only 877 genes in R. typhi) suggest that targeting essential biosynthetic pathways like phospholipid synthesis could be particularly effective. As R. typhi lacks alternative pathways for phosphatidylglycerol synthesis, pgsA inhibition might lead to non-viable bacteria with compromised membrane integrity.

Preliminary research suggests phosphatidylglycerol is essential for rickettsial membrane function, with no compensatory mechanisms identified in genomic analyses, positioning pgsA as a promising therapeutic target for future exploration.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.