Recombinant Rickettsia typhi NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Production

Recombinant R. typhi nuoK is a 110-amino acid protein (UniProt ID: Q68VV8) belonging to the proton-translocating NADH-quinone oxidoreductase (complex I) family . Key production features include:

  • Expression System: Full-length protein expressed in Escherichia coli with an N-terminal His tag for purification .

  • Sequence: Includes residues 1–110 of the native R. typhi nuoK, retaining functional domains .

  • Purity: >85% purity confirmed via SDS-PAGE .

ParameterDetails
Expression HostE. coli
TagN-terminal His tag
Molecular Weight~12.5 kDa (calculated)
Storage-20°C/-80°C in Tris-based buffer with 50% glycerol; avoid repeated freeze-thaw cycles

Role in Electron Transport

NADH-quinone oxidoreductase (complex I) catalyzes electron transfer from NADH to quinone, coupled with proton translocation across membranes. NuoK is a core subunit contributing to quinone binding and proton channel formation . Structural studies of homologous bacterial complexes (e.g., Vibrio cholerae) suggest nuoK aids in stabilizing the quinone-binding site and optimizing electron flow .

Biochemical Studies

  • Enzyme Kinetics: Used to assess NADH oxidation rates and inhibitor sensitivity (e.g., capsaicin analogs) .

  • Electron Transfer Mechanisms: Reconstituted into liposomes to study proton gradient generation .

Biotechnological Use

  • Antigen Production: Employed in ELISA kits for antibody detection due to its immunogenic properties .

  • Drug Target Screening: Tested against compounds targeting bacterial energy metabolism .

Comparative Analysis with Homologs

NuoK homologs across bacterial species share functional conservation but exhibit variability in sequence and regulation:

OrganismSubunit FeaturesApplications
Rickettsia typhi110 residues, His-tagged, expressed in E. coliPathogen metabolism studies
Mycobacterium bovis99 residues (UniProt A1KNF1), similar transmembrane topologyTuberculosis research
Vibrio choleraeSodium-pumping NADH:quinone oxidoreductase, 720 e⁻/s turnoverIon transport mechanisms

Challenges and Future Directions

  • Structural Resolution: High-resolution crystallography is needed to map nuoK’s role in R. typhi complex I .

  • Pathogenicity Link: Potential connections between nuoK function and R. typhi virulence remain unexplored .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; RT0778; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Target Names
nuoK
Target Protein Sequence
MLKILNMNEYISLNHYLILSSLVFTIGMFGLFMHRKNIINILMSIELMLLAVNINFVAFS VYMQELSGQIFSIIILTVAAAETAIGLAILLIYFRNKGSIKITDINKMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this specific organism, the enzyme's immediate electron acceptor is believed to be ubiquinone. It couples the redox reaction with proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), thereby conserving redox energy in a proton gradient.
Database Links

KEGG: rty:RT0778

STRING: 257363.RT0778

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-quinone oxidoreductase subunit K in Rickettsia typhi?

NADH-quinone oxidoreductase (Complex I) functions as the entry point for electrons in the respiratory chain of R. typhi, playing a critical role in energy metabolism. The nuoK subunit, specifically, contributes to the membrane domain of this complex and participates in proton translocation across the bacterial membrane.

In obligate intracellular pathogens like R. typhi, respiratory chain components are particularly important for adaptation to the host cell environment. Unlike some bacteria that have undergone extreme genome reduction, R. typhi maintains functional respiratory chain complexes, including nuoK, which suggests its essential role in rickettsial bioenergetics and survival within host cells . The evolutionary conservation of these respiratory components contrasts with the variable presence of other genes like phospholipases, which show evidence of pseudogenization across rickettsial evolution .

How does the genomic context of nuoK compare between virulent and mild Rickettsia species?

Research comparing genomic features between virulent and milder Rickettsia species reveals distinct patterns relevant to nuoK and other metabolic components. Virulent species like R. typhi exhibit more genome reduction and fewer mobile genetic elements compared to less pathogenic species .

CharacteristicVirulent Rickettsia (e.g., R. typhi)Milder Rickettsia Species
Genome SizeSmallerLarger
Core Gene ConservationHigher between virulent species (98% aa identity)Lower between milder species (96% aa identity)
Mobile Genetic ElementsFewer (5 genes in virulent vs. 29-41 in milder species)More abundant
Plasmid PresenceTypically plasmidlessOften harbor 1-4 plasmids
Metabolic GenesMore conservedMore variable

This genomic context affects research approaches when working with nuoK and other components of the respiratory chain, particularly when considering expression systems and functional studies .

What expression challenges are unique to nuoK compared to other Rickettsia proteins?

The expression of recombinant nuoK presents several challenges distinct from other rickettsial proteins. Unlike secreted proteins such as phospholipases Pat1 and Pat2 that have been successfully expressed and characterized , nuoK is a hydrophobic membrane protein with multiple transmembrane domains.

Key challenges include:

  • Proper membrane insertion during heterologous expression

  • Maintaining protein stability outside its native complex

  • Achieving correct folding in expression systems

  • Potential toxicity to host cells due to interference with host respiratory functions

These challenges are compounded by R. typhi's obligate intracellular lifestyle, which has traditionally limited genetic manipulation. Recent advances in transformation techniques, such as those demonstrated with GFPuv-expressing recombinant R. typhi, provide promising avenues for nuoK studies .

What are the optimal experimental conditions for expressing recombinant nuoK?

The optimal expression of recombinant nuoK requires careful consideration of several experimental parameters:

  • Expression System Selection: While E. coli is commonly used for recombinant protein expression, membrane proteins like nuoK may benefit from expression in systems that better accommodate membrane protein folding, such as specialized E. coli strains (C41/C43) or eukaryotic systems.

  • Vector Design: Incorporating the pRAM18dRGA plasmid system, which has been successfully used for R. typhi transformation, offers a promising approach . This system allows for stable maintenance under antibiotic selection both in vitro and in vivo.

  • Fusion Partners: Adding solubility-enhancing tags or fluorescent proteins like GFPuv can improve expression and enable tracking. The successful expression of GFPuv in R. typhi demonstrates the feasibility of this approach .

  • Induction Conditions: Optimizing temperature, inducer concentration, and expression duration is critical for membrane proteins, with lower temperatures (16-20°C) often yielding better results for complex membrane proteins.

  • Extraction Methods: Specialized detergents are required for membrane protein solubilization, with mild non-ionic or zwitterionic detergents often proving most effective for maintaining nuoK structure and function.

How can researchers distinguish between native and recombinant nuoK in functional studies?

Distinguishing between native and recombinant nuoK is essential for accurate functional characterization:

  • Epitope Tagging: Adding small epitope tags (His, FLAG, etc.) to recombinant nuoK allows specific detection via western blotting without significantly altering protein function. This approach has been validated in R. typhi with other proteins .

  • Differential Expression Analysis: Quantitative comparison of nuoK expression levels between wild-type and recombinant strains using RT-qPCR provides a measure of overexpression.

  • Protein Localization: Immunofluorescence microscopy using tag-specific antibodies can verify proper localization of recombinant nuoK to the membrane, similar to approaches used for Pat1 and Pat2 localization studies .

  • Activity Assays: NADH oxidation assays with isolated membrane fractions can assess functional differences between native and recombinant nuoK-containing complexes.

  • Complementation Studies: In nuoK knockout or knockdown backgrounds, functional complementation with recombinant nuoK provides strong evidence of proper expression and function.

These methodologies should be adapted based on whether nuoK is expressed in R. typhi itself or in heterologous systems.

How do mutations in nuoK affect Rickettsia typhi viability and virulence?

Mutations in nuoK can significantly impact R. typhi viability and virulence through several mechanisms:

The relationship between respiratory chain function and virulence appears consistent with broader patterns of reductive evolution in rickettsial species, where more virulent species like R. typhi show evidence of genome reduction compared to less virulent species . This supports the hypothesis that modifications to core metabolic functions, including nuoK, may have significant implications for pathogenicity.

What genetic manipulation tools are most effective for nuoK studies in Rickettsia typhi?

Recent advances have expanded the genetic manipulation toolkit for R. typhi, offering several approaches for nuoK studies:

  • Plasmid-Based Expression: The pRAM18dRGA plasmid has been successfully used to transform R. typhi, enabling expression of heterologous proteins like GFPuv . This system can be adapted for nuoK expression with appropriate promoters and regulatory elements.

  • Transposon Mutagenesis: For loss-of-function studies, transposon-based approaches can generate insertion mutants, though the essential nature of respiratory chain components may limit viable mutants.

  • CRISPR-Cas Systems: Though challenging to implement in obligate intracellular bacteria, modified CRISPR-Cas approaches are being developed for rickettsial species.

  • Antisense RNA: For nuoK knockdown studies, antisense RNA approaches may allow modulation of expression without complete gene inactivation.

  • Heterologous Expression: When direct manipulation in R. typhi proves challenging, expression in surrogate systems followed by biochemical and structural characterization remains valuable.

The selection of genetic tools should consider the significant challenges posed by R. typhi's obligate intracellular lifestyle and potential essentiality of nuoK .

How can researchers resolve contradictory data in nuoK functional studies?

When faced with contradictory results in nuoK studies, researchers should systematically evaluate:

  • Experimental Conditions: Variations in growth conditions, host cell types, or expression systems can significantly impact results for rickettsial proteins .

  • Protein Conformation: Membrane proteins like nuoK are particularly sensitive to extraction and purification methods, potentially leading to contradictory functional data.

  • Strain Differences: Genetic variations between R. typhi strains may contribute to functional differences, as observed in other rickettsial species .

  • Technical Validation: Implementing multiple orthogonal techniques to verify findings helps distinguish true biological effects from technical artifacts .

  • Data Integration: Combining proteomic, genomic, and biochemical approaches provides a more comprehensive understanding of nuoK function in the context of the complete respiratory chain .

When confronting contradictory data, researchers should systematically analyze potential sources of variation, implement additional controls, and refine experimental protocols to resolve discrepancies .

What are the most reliable methods for assessing nuoK interaction with other respiratory chain components?

Understanding nuoK interactions within the respiratory chain requires specialized approaches:

  • Blue Native PAGE: This technique allows separation of intact respiratory complexes, enabling assessment of nuoK incorporation into Complex I structures.

  • Co-Immunoprecipitation: Using tagged versions of nuoK to pull down interacting partners can identify both expected and novel interactions within the respiratory chain.

  • Crosslinking Mass Spectrometry: Chemical crosslinking followed by mass spectrometry analysis can map specific interaction points between nuoK and neighboring subunits.

  • Bacterial Two-Hybrid Systems: Modified bacterial two-hybrid approaches can detect protein-protein interactions involving membrane proteins like nuoK.

  • Cryo-EM Analysis: Advanced structural biology techniques can reveal nuoK position and interactions within the complete Complex I architecture.

These approaches should be adapted to the challenges of working with an obligate intracellular pathogen, potentially leveraging the recombinant expression systems established for R. typhi .

How should researchers design experiments to compare nuoK function across different Rickettsia species?

Comparative studies of nuoK across Rickettsia species require careful experimental design:

  • Sequence Analysis Groundwork: Begin with comprehensive bioinformatic comparison of nuoK sequences across species, noting conservation patterns similar to those observed in other rickettsial proteins .

SpeciesnuoK Sequence Identity (%)Virulence ProfileGenomic Context
R. typhi100 (reference)High virulenceReduced genome
R. prowazekii~98High virulenceReduced genome
R. conorii~95High virulenceIntermediate genome
R. massiliae~95Mild virulenceLarger genome
  • Standardized Expression Systems: Use identical expression vectors and conditions when comparing nuoK from different species to minimize system-dependent variables.

  • Functional Assays: Implement standardized biochemical assays measuring NADH oxidation rates, proton pumping efficiency, and contribution to membrane potential.

  • Heterologous Complementation: Test functional equivalence through cross-species complementation studies in model systems.

  • Host Cell Interaction: Evaluate how nuoK variants from different species affect interactions with host cell mitochondria and metabolism.

This approach enables correlation of nuoK functional characteristics with the established virulence patterns observed across rickettsial species .

What controls are essential when studying post-translational modifications of nuoK?

Investigating post-translational modifications (PTMs) of nuoK requires rigorous controls:

  • Sample Preparation Controls:

    • Compare native R. typhi nuoK with recombinant versions

    • Include both infected host cells and purified rickettsiae

    • Process samples with PTM-preserving protocols (phosphatase inhibitors, etc.)

  • Mass Spectrometry Controls:

    • Analyze both tryptic and alternative protease digestions to ensure complete coverage

    • Include synthetic peptides with known modifications as standards

    • Implement label-free and isotope-labeled quantification approaches

  • Biological Validation:

    • Generate site-directed mutants at putative modification sites

    • Compare PTM patterns across growth conditions and infection stages

    • Assess conservation of modification sites across rickettsial species

  • Functional Correlation:

    • Correlate identified PTMs with respiratory chain activity measurements

    • Investigate temporal dynamics of modifications during infection

    • Compare PTM patterns between virulent and attenuated strains

These controls help distinguish genuine biological PTMs from technical artifacts, a particular concern when working with membrane proteins from obligate intracellular bacteria.

How can microscopy techniques be optimized to study nuoK localization in infected cells?

Optimizing microscopy for nuoK localization studies requires specialized approaches:

  • Sample Preparation:

    • Fix infected cells using methods that preserve membrane structures

    • Implement gentle permeabilization protocols to maintain bacterial membrane integrity

    • Use antigen retrieval techniques optimized for membrane proteins

  • Immunolabeling Strategy:

    • Develop highly specific antibodies against nuoK or epitope tags

    • Implement dual-labeling approaches to distinguish nuoK from other rickettsial proteins

    • Include controls to verify antibody specificity in uninfected and infected cells

  • Imaging Techniques:

    • Employ super-resolution microscopy (STORM, PALM) to resolve membrane localization

    • Use immuno-electron microscopy for precise subcellular localization

    • Implement live-cell imaging with fluorescent fusion proteins similar to GFPuv approaches

  • Quantitative Analysis:

    • Develop automated image analysis workflows for unbiased quantification

    • Implement colocalization analysis with other respiratory chain components

    • Compare localization patterns across infection stages and host cell types

These approaches build upon successful visualization strategies demonstrated for other rickettsial proteins, adapting them to the specific challenges of membrane-associated nuoK .

What are the most common pitfalls in nuoK purification and how can they be addressed?

The purification of nuoK presents several challenges that researchers should anticipate:

  • Limited Expression:

    • Problem: Poor expression levels or insoluble aggregates

    • Solution: Screen multiple expression systems, including specialized membrane protein hosts, and optimize induction conditions (lower temperature, gentler induction)

  • Complex Dissociation:

    • Problem: Loss of interaction partners during purification

    • Solution: Implement mild detergent extraction protocols and consider co-expression with interacting subunits

  • Protein Instability:

    • Problem: Rapid degradation after extraction from membrane

    • Solution: Include protease inhibitors, optimize buffer compositions, and minimize purification steps

  • Functional Loss:

    • Problem: Purified protein lacks expected activity

    • Solution: Verify function in membrane fragments before complete purification and consider lipid reconstitution

  • Contamination Issues:

    • Problem: Host cell proteins co-purifying with nuoK

    • Solution: Implement multiple orthogonal purification steps and validate identity by mass spectrometry

Learning from approaches used for other rickettsial membrane proteins can help address these challenges and improve success rates in nuoK purification.

How should researchers interpret unexpected functional data from nuoK mutants?

When nuoK mutants produce unexpected functional results, a systematic analytical approach helps resolve apparent contradictions:

This approach aligns with best practices for resolving contradictory data in scientific research, particularly when working with complex biological systems .

How can structural biology approaches enhance our understanding of nuoK function?

Advanced structural biology techniques offer promising avenues for nuoK research:

  • Cryo-Electron Microscopy:

    • Determine the structure of rickettsial Complex I with atomic or near-atomic resolution

    • Compare structures in different functional states to understand conformational changes

    • Identify specific structural features that distinguish rickettsial nuoK from homologs

  • Integrative Structural Approaches:

    • Combine computational modeling with experimental constraints from crosslinking and mass spectrometry

    • Implement molecular dynamics simulations to understand nuoK movement during the catalytic cycle

    • Use hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • In Situ Structural Analysis:

    • Apply cryo-electron tomography to visualize nuoK-containing complexes within intact bacteria

    • Implement correlative light and electron microscopy for functional-structural integration

    • Develop proximity labeling approaches to map the nuoK interaction network

These approaches would significantly advance our understanding of how nuoK contributes to respiratory function in this obligate intracellular pathogen, potentially revealing adaptations specific to the intracellular lifestyle.

What emerging technologies could revolutionize the study of nuoK and other rickettsial membrane proteins?

Several emerging technologies hold particular promise for advancing nuoK research:

  • Nanobody Development:

    • Generate camelid antibody fragments (nanobodies) against nuoK epitopes

    • Use nanobodies as crystallization chaperones for structural studies

    • Develop intracellular nanobodies for live-cell visualization and perturbation

  • Minimally Invasive Genome Editing:

    • Adapt base editing and prime editing technologies for rickettsial applications

    • Implement CRISPR interference systems for conditional knockdown studies

    • Develop synthetic genetic circuits for controlled expression in rickettsiae

  • Advanced Biophysical Approaches:

    • Implement single-molecule FRET to study nuoK conformational changes

    • Apply native mass spectrometry to intact respiratory complexes

    • Develop nanoscale respirometry methods for direct measurement of rickettsial bioenergetics

  • Artificial Intelligence Applications:

    • Use machine learning for improved structure prediction and functional annotation

    • Implement AI-driven experimental design to optimize expression and purification

    • Develop automated image analysis workflows for high-throughput phenotypic studies

These technologies could overcome many current limitations in the study of challenging membrane proteins from obligate intracellular pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.