Recombinant Rickettsia typhi Phosphatidate cytidylyltransferase (cdsA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Phosphatidate cytidylyltransferase (CdsA) is a key enzyme in phospholipid biosynthesis, catalyzing the conversion of phosphatidic acid (PA) and cytidine triphosphate (CTP) to cytidine diphosphate-diacylglycerol (CDP-DAG). This lipid intermediate is critical for synthesizing phosphatidylglycerol (PG) and cardiolipin (CL), essential components of bacterial membranes . In Rickettsia typhi, CdsA is hypothesized to maintain membrane integrity and support intracellular survival, though direct studies on its recombinant form remain limited.

Recombinant Expression and Purification

While recombinant R. typhi CdsA has not been explicitly documented, insights can be drawn from homologs. For example, recombinant Aquifex aeolicus CdsA (UniProt: O67292) expressed in E. coli exhibits the following properties :

  • Expression System: E. coli with N-terminal His tag.

  • Purity: >90% (SDS-PAGE).

  • Stability: Lyophilized powder stored at -80°C with Tris/PBS buffer and 6% trehalose.

  • Sequence: MRITQGERESSGEFLMSREFYGVLIGVTTLLVIFLPKSLFLLVILFLCFAISREVSVALG...

Functional Insights from Related Species

  • Membrane Lipid Alterations: In Streptococcus mitis, CdsA mutations reduce PG and CL levels, increase phosphatidic acid, and confer antibiotic resistance by disrupting membrane microdomains .

  • Enzymatic Activity: Thermotoga maritima CdsA requires a cation-binding Asp-Asp dyad for catalysis, a feature conserved in R. typhi (Asp222) .

Potential Applications and Research Gaps

  • Antimicrobial Targets: CdsA’s role in lipid metabolism makes it a candidate for disrupting R. typhi membrane integrity .

  • Genetic Tools: While R. typhi has been engineered to express GFPuv , recombinant CdsA could enable studies on lipid-dependent pathogenesis.

Challenges and Future Directions

  • Expression Difficulties: R. typhi’s obligate intracellular lifestyle complicates recombinant protein production.

  • Functional Validation: Direct assays are needed to confirm enzymatic activity and substrate specificity in R. typhi.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery times may vary depending on the purchase method and location. We recommend consulting your local distributors for specific delivery time estimates.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference point.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cdsA; RT0410; Phosphatidate cytidylyltransferase; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Target Names
cdsA
Target Protein Sequence
MITQKEKEHLAKDKQNIYLRIISGIVLVSLFVVAILWFKTLFYILMILVGLGMLSEWCNM TSSSIHYLLIGFIIIPIPISLLIFLSTQESNRLVIMLYFCIIWSVDTFAMIGGKTFKGTK LAPKISPKKTWTGLIIGTISAGLIAVLVSLIPYYHIENYYFSNKIYLFIISCILALIAQS SDLFISYFKRKFNIKDSGHIIPGHGGVLDRFDSIILTAPVFFGINIYL
Uniprot No.

Target Background

Database Links

KEGG: rty:RT0410

STRING: 257363.RT0410

Protein Families
CDS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Phosphatidate cytidylyltransferase (cdsA) and what role does it play in Rickettsia typhi biology?

Phosphatidate cytidylyltransferase (cdsA) is an essential enzyme involved in phospholipid biosynthesis in Rickettsia typhi. It catalyzes the conversion of phosphatidic acid to CDP-diacylglycerol, a critical intermediate in the synthesis of membrane phospholipids. In obligate intracellular bacteria like Rickettsia, phospholipid biosynthesis is particularly important for membrane formation and integrity during bacterial replication within host cells. The enzyme, also referred to as CDP-diglyceride synthetase in some species, plays a central role in bacterial membrane biogenesis and is therefore critical for rickettsial viability and pathogenesis . Like other rickettsial species, R. typhi depends on robust membrane biosynthesis pathways to support its intracellular lifestyle and cell-to-cell spread mechanisms that differ from those of spotted fever group rickettsiae .

Why is cdsA considered a potential target for studying rickettsial pathogenesis?

The cdsA enzyme is considered a valuable target for studying rickettsial pathogenesis for several compelling reasons. First, as a critical enzyme in phospholipid biosynthesis, cdsA is essential for bacterial membrane integrity and replication within host cells. Second, the pathways involving phospholipid metabolism are central to rickettsial interaction with host cell membranes during invasion and intracellular survival. Third, unlike spotted fever group rickettsiae that utilize actin-based motility for cell-to-cell spread, typhus group organisms like R. typhi rely more heavily on proper membrane dynamics for their erratic movement patterns and eventual host cell lysis for dissemination . Understanding cdsA function could provide insights into these infection mechanisms. Finally, as membrane biosynthesis enzymes are often conserved but sufficiently distinct from host enzymes, cdsA represents a potential therapeutic target, making its study valuable from both fundamental and applied research perspectives.

What are the recommended expression systems for producing functional recombinant Rickettsia typhi cdsA?

For the successful expression of functional recombinant Rickettsia typhi cdsA, researchers have several options with distinct advantages. The cell-free expression system has proven particularly effective for rickettsial proteins, as evidenced by its use for recombinant phosphatidate cytidylyltransferase from other Rickettsia species like R. bellii and R. felis . This approach bypasses challenges associated with potential toxicity to host cells. Alternatively, E. coli-based expression systems can be employed with optimization of codon usage and expression conditions to minimize issues related to membrane protein folding. For more complex studies requiring post-translational modifications, baculovirus or mammalian cell expression systems may be preferable despite lower yields . When using these systems, fusion tags (such as His6, GST, or MBP) should be strategically placed to minimize interference with the catalytic activity of cdsA. Temperature optimization is crucial, with expression typically performed at lower temperatures (16-25°C) to enhance proper folding of this membrane-associated enzyme. Regardless of the chosen system, purification under conditions that preserve the native conformation of the enzyme is essential for obtaining functionally active recombinant cdsA.

What are the key challenges in expressing and purifying active Rickettsia typhi cdsA, and how can they be overcome?

Expressing and purifying active Rickettsia typhi cdsA presents several significant challenges. First, as a membrane-associated enzyme, cdsA often exhibits hydrophobic regions that can cause protein aggregation during expression and purification. This can be addressed by using mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin during extraction and purification. Second, rickettsial proteins frequently contain rare codons that may limit expression efficiency in heterologous systems. Researchers can overcome this by using codon-optimized synthetic genes or specialized E. coli strains supplemented with rare tRNAs . Third, maintaining the enzymatic activity during purification requires careful consideration of buffer conditions, particularly pH, salt concentration, and the presence of stabilizing agents like glycerol or specific lipids. Finally, the obligate intracellular nature of Rickettsia typhi means that certain post-translational modifications may be required for full activity, potentially necessitating eukaryotic expression systems in cases where prokaryotic hosts prove insufficient . For challenging rickettsial proteins, cell-free expression systems have shown promise as demonstrated with related phosphatidate cytidylyltransferases from R. bellii and R. felis, achieving purities of greater than 85% as determined by SDS-PAGE .

How can researchers validate the enzymatic activity of recombinant Rickettsia typhi cdsA?

Validating the enzymatic activity of recombinant Rickettsia typhi cdsA requires multiple complementary approaches. The primary functional assay involves measuring the conversion of phosphatidic acid to CDP-diacylglycerol, which can be quantified using radiolabeled substrates (typically [³²P]CTP) or through coupled enzyme assays that detect pyrophosphate release. For enhanced sensitivity and throughput, researchers can employ HPLC or mass spectrometry-based methods to directly quantify CDP-diacylglycerol formation. Proper controls are essential, including heat-inactivated enzyme and known inhibitors of phosphatidate cytidylyltransferase activity, such as certain divalent cation chelators. Structural integrity should be assessed through circular dichroism spectroscopy, which provides information about secondary structure content, and thermal shift assays to evaluate protein stability. Additionally, researchers can perform comparative enzymatic kinetics with cdsA from other rickettsial species where activity has been well-characterized, such as R. bellii or R. felis . For definitive validation in a biological context, complementation studies in bacterial mutants deficient in cdsA function can demonstrate the ability of the recombinant R. typhi enzyme to restore phospholipid biosynthesis pathways.

How can recombinant Rickettsia typhi cdsA be used to study host-pathogen interactions?

Recombinant Rickettsia typhi cdsA offers a powerful tool for dissecting the intricate host-pathogen interactions during rickettsial infection. Researchers can use the purified enzyme to investigate its potential interactions with host cell factors through techniques such as pull-down assays, surface plasmon resonance, or proximity labeling approaches. These methods may reveal whether cdsA interacts with host phospholipid biosynthesis machinery or membrane-associated signaling complexes during infection. Additionally, recombinant cdsA can be employed in structural studies, including crystallography or cryo-electron microscopy, to determine its three-dimensional structure and identify potential sites for inhibitor design. For cellular studies, fluorescently tagged recombinant cdsA can be used to track its localization during different stages of infection, potentially revealing redistribution of phospholipid biosynthesis machinery during bacterial replication and dissemination. Building on approaches used with GFPuv-expressing R. typhi, researchers can utilize recombinant cdsA to develop assays for monitoring immune responses directed against this protein, which may contribute to protective immunity . Finally, cdsA-specific antibodies generated using the recombinant protein can be employed for immunolocalization studies to determine the subcellular distribution of this enzyme during the rickettsial life cycle.

How does recombinant Rickettsia typhi cdsA research integrate with GFPuv-expressing recombinant Rickettsia models?

The integration of recombinant Rickettsia typhi cdsA research with GFPuv-expressing recombinant Rickettsia models offers powerful synergistic approaches for studying rickettsial biology and pathogenesis. GFPuv-expressing R. typhi strains have been successfully developed and demonstrate normal replication kinetics, stable plasmid maintenance under antibiotic selection, and unaltered pathogenicity in mouse models . These fluorescent bacteria provide excellent platforms for tracking infection dynamics in real-time. By extending this technology to co-express both GFPuv and modified versions of cdsA (such as tagged, mutant, or overexpression constructs), researchers can simultaneously visualize bacterial localization while manipulating cdsA function. For instance, a strain expressing both GFPuv and a dominant-negative cdsA variant could reveal how phospholipid biosynthesis disruption affects bacterial replication and dissemination in cell culture and animal models. Additionally, the established methods for transformation and plasmid maintenance in R. typhi that enabled GFPuv expression can be directly applied to introducing constructs for cdsA manipulation . The immunological research applications demonstrated with GFPuv-expressing R. typhi, particularly CD8+ T cell response analysis, could be extended to assess immune responses specifically targeting cdsA or phospholipid biosynthesis pathways, potentially revealing new aspects of protective immunity against rickettsial infections.

What are the implications of studying phospholipid biosynthesis through cdsA for understanding Rickettsia typhi's unique cell-to-cell spread mechanisms?

Studying phospholipid biosynthesis through cdsA has profound implications for understanding Rickettsia typhi's distinctive cell-to-cell spread mechanisms. Unlike spotted fever group rickettsiae that utilize actin-based motility driven by proteins like RickA for directional movement and cell-to-cell spread, R. typhi exhibits erratic motility patterns and relies more heavily on host cell lysis for dissemination . This fundamental difference in spread strategy likely involves differential membrane dynamics and phospholipid composition, making cdsA a key enzyme in this process. Phosphatidate cytidylyltransferase activity influences membrane fluidity, curvature, and fusion properties through its role in synthesizing precursors for various phospholipids. By manipulating cdsA expression or activity in recombinant R. typhi strains, researchers can investigate how alterations in phospholipid biosynthesis affect the bacterium's ability to replicate to high numbers within host cells before lysis and subsequent infection of neighboring cells . Time-lapse microscopy of fluorescently labeled recombinant R. typhi with modified cdsA activity could reveal whether phospholipid biosynthesis plays a role in the erratic movement patterns observed. Furthermore, comparing the membrane composition of typhus group versus spotted fever group rickettsiae may uncover critical differences in phospholipid profiles that explain their distinct spread mechanisms, with implications for developing targeted therapeutics that disrupt this essential aspect of rickettsial pathogenesis.

How can multi-omics approaches be combined with recombinant cdsA studies to provide a systems-level understanding of Rickettsia typhi pathogenesis?

Integrating multi-omics approaches with recombinant cdsA studies can provide unprecedented systems-level insights into Rickettsia typhi pathogenesis. Transcriptomics analysis comparing wild-type and cdsA-modified R. typhi strains can reveal compensatory gene expression changes in response to altered phospholipid biosynthesis, potentially identifying regulatory networks connected to this pathway. Metabolomics profiling focusing on phospholipids and their precursors/derivatives can directly measure the impact of cdsA manipulation on the bacterium's lipidome, with implications for membrane structure and function during infection. Proteomics studies of host cells infected with recombinant R. typhi expressing modified cdsA can identify host factors whose expression or post-translational modifications are specifically altered in response to changes in bacterial phospholipid biosynthesis. For advanced integration, researchers can employ spatial transcriptomics or imaging mass spectrometry to map the distribution of specific mRNAs or lipid species within infected tissues from animal models, such as the CB17 SCID mice used for R. typhi infection studies . This approach could reveal tissue-specific adaptations in phospholipid metabolism during infection. Computational modeling using these multi-omics datasets can generate predictive frameworks for how phospholipid biosynthesis interfaces with other aspects of rickettsial physiology, including nutrient acquisition, stress responses, and virulence factor expression, providing a comprehensive systems-level understanding of R. typhi pathogenesis that extends far beyond the traditional reductionist approaches.

What are the optimal buffer conditions for maintaining recombinant Rickettsia typhi cdsA stability and activity?

Maintaining optimal stability and activity of recombinant Rickettsia typhi cdsA requires careful consideration of buffer composition. Based on experience with related phosphatidate cytidylyltransferases, a recommended starting buffer consists of 50 mM HEPES or Tris-HCl at pH 7.4-7.8, supplemented with 100-150 mM NaCl to provide ionic strength without protein denaturation. The addition of 10-20% glycerol serves as a cryoprotectant and stabilizes protein structure during storage. Since cdsA is a membrane-associated enzyme, the presence of mild detergents such as 0.05-0.1% n-dodecyl-β-D-maltoside (DDM) or digitonin is crucial for maintaining solubility while preserving the native conformation. Divalent cations, particularly Mg²⁺ at 5-10 mM concentration, are essential cofactors for enzymatic activity. Additionally, including 1-2 mM DTT or 5 mM β-mercaptoethanol protects catalytic cysteine residues from oxidation. For long-term storage, addition of specific phospholipids such as phosphatidylglycerol (0.1-0.5 mg/mL) may further stabilize the enzyme by mimicking its natural membrane environment. Storage should be at -80°C in small single-use aliquots to avoid repeated freeze-thaw cycles. When performing activity assays, the buffer should be supplemented with substrates at concentrations exceeding their Km values, typically 0.2-0.5 mM phosphatidic acid and 1-2 mM CTP, to ensure optimal enzymatic activity measurement.

How should researchers address the challenge of low expression yields when producing recombinant Rickettsia typhi cdsA?

Addressing low expression yields of recombinant Rickettsia typhi cdsA requires a systematic optimization approach targeting multiple aspects of the expression system. First, codon optimization for the expression host is crucial, as rickettsial genomes often contain codons rarely used in common expression hosts like E. coli. Synthetic gene constructs with optimized codons can significantly improve translation efficiency. Second, testing multiple expression vectors with different promoters (T7, tac, araBAD) can identify optimal transcriptional control for cdsA. Third, fusion partners such as MBP, NusA, or SUMO can enhance solubility and expression levels of challenging proteins, with the added benefit of providing affinity purification tags. Fourth, expression host strains specifically designed for membrane proteins or those containing additional tRNAs for rare codons should be evaluated. Fifth, induction conditions require careful optimization - lower temperatures (16-20°C), reduced inducer concentrations, and extended expression times often favor proper folding of complex proteins. For particularly recalcitrant targets, cell-free expression systems have proven effective for rickettsial phosphatidate cytidylyltransferases from related species . Finally, if conventional approaches fail, researchers can consider alternative expression platforms such as the insect cell/baculovirus system, which often provides superior results for difficult-to-express bacterial proteins. Throughout optimization, expression should be monitored using sensitive detection methods such as Western blotting rather than relying solely on total protein staining, as initial expression levels may be below the detection limit of general protein stains.

What controls should be included in enzymatic assays for recombinant Rickettsia typhi cdsA to ensure reliable results?

Designing rigorous enzymatic assays for recombinant Rickettsia typhi cdsA necessitates multiple controls to ensure reliable and interpretable results. A no-enzyme control is essential to establish baseline measurements and account for any non-enzymatic conversion of substrates or background signal in the detection system. Heat-inactivated cdsA (typically treated at 95°C for 15 minutes) serves as a negative control to confirm that the observed activity specifically results from the properly folded enzyme rather than contaminants in the preparation. Including a known cdsA inhibitor control, such as phenylmercuric acetate or certain phospholipid analogs, validates the specificity of the assay. For quantitative measurements, a standard curve using commercially available CDP-diacylglycerol (or an appropriate surrogate standard) should be prepared to calibrate detection methods and enable accurate quantification of enzyme activity. Time-course controls with measurements at multiple timepoints ensure that activity is measured within the linear range of the reaction. Substrate titration controls across a range of concentrations allow determination of kinetic parameters (Km, Vmax) and help optimize assay conditions. When possible, a positive control using a well-characterized phosphatidate cytidylyltransferase from a related organism, such as R. bellii or R. felis , provides a benchmark for expected activity levels. Finally, buffer composition controls testing the necessity of specific components (particularly divalent cations and detergents) confirm the optimal conditions for enzymatic activity and help distinguish between effects on enzyme stability versus catalytic activity.

What are the prospects for developing a conditionally lethal Rickettsia typhi strain through cdsA manipulation?

The development of a conditionally lethal Rickettsia typhi strain through cdsA manipulation represents an ambitious yet potentially transformative direction for rickettsial research. Building on the successful transformation of R. typhi with plasmids expressing GFPuv , researchers could engineer constructs placing the native cdsA under control of an inducible promoter while introducing a chromosomal deletion or disruption of the endogenous gene. This approach would create a strain dependent on exogenous inducer molecules for cdsA expression and consequently for viability. The challenge lies in identifying appropriate inducible systems functional in the unique intracellular environment of R. typhi. Candidate systems include tetracycline-responsive elements, riboswitch-based controls, or degron-based protein destabilization domains that respond to small molecules. The availability of plasmid systems that are stably maintained in R. typhi under antibiotic selection in both in vitro and in vivo conditions provides the necessary framework for this genetic engineering. A conditionally lethal strain would enable unprecedented studies of cdsA essentiality and function, allowing researchers to deplete the enzyme gradually and observe the sequential effects on bacterial physiology. Moreover, such a strain could serve as an attenuated vaccine platform, capable of establishing initial infection to stimulate robust immunity but susceptible to controlled elimination through withdrawal of the inducer. The successful development of this technology would revolutionize rickettsial genetics beyond the current transposon mutagenesis and GFP expression systems , opening new avenues for investigating essential genes and developing novel vaccination strategies.

How might comparative studies of cdsA across rickettsial species reveal evolutionary adaptations in phospholipid metabolism?

Comparative studies of cdsA across rickettsial species offer a window into the evolutionary adaptations of phospholipid metabolism that may underlie differences in pathogenicity and host range. By analyzing recombinant cdsA enzymes from diverse rickettsial species such as R. typhi, R. prowazekii, R. rickettsii, R. bellii, and R. felis , researchers can identify conserved catalytic residues as well as species-specific variations that may correlate with infection strategies. Structural biology approaches, including X-ray crystallography or cryo-electron microscopy of these recombinant enzymes, could reveal how subtle differences in protein architecture influence substrate specificity, catalytic efficiency, or regulation. Enzymatic characterization comparing kinetic parameters across species may uncover adaptations in phospholipid biosynthesis rates that align with the distinct replication and dissemination strategies observed between typhus group and spotted fever group rickettsiae . Genomic context analysis of the cdsA locus across species could identify differences in gene organization and regulatory elements that reflect evolutionary pressures on phospholipid metabolism. Integration of these comparative data with information about each species' host range, tissue tropism, and transmission vectors may reveal correlations between phospholipid biosynthesis characteristics and ecological niches. Finally, tracking molecular signatures of selection on cdsA sequences across the rickettsial phylogeny could identify key adaptive events that contributed to the divergence of rickettsial lineages, potentially linking phospholipid metabolism to major evolutionary transitions in these fascinating pathogens.

What potential exists for developing a recombinant Rickettsia typhi strain expressing both cdsA variants and fluorescent markers for in vivo tracking of phospholipid biosynthesis?

The development of a recombinant Rickettsia typhi strain expressing both cdsA variants and fluorescent markers holds tremendous potential for real-time tracking of phospholipid biosynthesis during infection. Such a system could be engineered by building upon the successful GFPuv-expressing R. typhi platform , which has demonstrated stable plasmid maintenance and protein expression without altering pathogenicity. Researchers could design constructs expressing the native cdsA fused to one fluorescent protein (e.g., mCherry) while simultaneously expressing a modified variant (e.g., catalytically inactive mutant) fused to a spectrally distinct fluorescent protein (e.g., GFPuv). This dual-color system would enable visualization of the subcellular localization and potential redistribution of active versus inactive cdsA during different stages of infection. To directly monitor phospholipid biosynthesis products, the system could be further enhanced by incorporating fluorescent lipid sensors or FRET-based reporters responsive to CDP-diacylglycerol or derivative phospholipids. The established capacity of R. typhi to maintain plasmids during in vivo infection of mouse models suggests that such a system could track phospholipid dynamics in animal tissues, not just cell culture. This would provide unprecedented insights into how phospholipid biosynthesis contributes to bacterial replication, membrane integrity, and host cell interaction in physiologically relevant contexts. Beyond basic research applications, this technology could serve as a platform for high-content screening of compounds targeting phospholipid biosynthesis, as changes in fluorescence patterns would provide immediate readouts of compound effects on enzyme localization and function during active infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.