Recombinant Rickettsia typhi Probable ABC transporter permease protein RT0041 (RT0041)

Shipped with Ice Packs
In Stock

Description

Production and Supplier Information

RT0041 is commercially available from specialized biotechnology suppliers, with variations in pricing and product codes:

SupplierProduct CodePriceCountry
Biomatik CorporationRT0041 (partial)$802.00China
CUSABIO TECHNOLOGY LLCCSB-EP734727RNE1$388China

Both suppliers provide recombinant proteins with high purity, suitable for biochemical assays, immunological studies, and pathogenesis research .

Pathogenesis and Infection Models

Recombinant RT0041 could serve as a tool for studying Rickettsia typhi’s interaction with host cells. For example:

  • Surface Protein Studies: RT0041 may complement studies on Rickettsia surface proteins (e.g., Sca family autotransporters), which are critical for host cell invasion .

  • Immune Response Analysis: Though not directly tested for RT0041, GFPuv-expressing Rickettsia typhi (as in ) demonstrates the utility of recombinant proteins in tracking infection dynamics and immune cell responses.

Challenges in Functional Validation

  • Limited Genetic Manipulation Tools: Rickettsia typhi’s obligate intracellular lifestyle complicates knockout or knock-in studies .

  • Genetic Conservation: Whole-genome comparisons show minimal genetic variation among Rickettsia typhi isolates, suggesting conserved functional roles for RT0041 .

Comparative Analysis of ABC Transporters in Rickettsia

ABC transporters are critical for Rickettsia survival. Below is a comparison of RT0041 with other characterized ABC transporters:

ProteinOrganismProposed FunctionKey Features
RT0041Rickettsia typhiNutrient transport or secretionPartial sequence, His/Myc tags
Sca ProteinsRickettsia typhiHost cell adhesion/entryAutotransporter family, surface-exposed
ABC TransportersRickettsia prowazekiiLysine uptakeHigh substrate specificity

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your usage.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
RT0041; Probable ABC transporter permease protein RT0041
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Target Names
RT0041
Target Protein Sequence
MLLNIANLVGKHTIKFAQSVGIFALFSFIAISSIIKPPLYLSLIMRQLLFIGFHSLPVVA MTTFFSGAVLALQSYTGFSRFSAENSIATVVVLSLTRELGPVLAGLIVAGRVGASIAAEI ATMKVTEQVDALYTLSTDPIKYLVCPRVIAAIITMPCLVLIGDVIGVMGGYLVGIYKLNF NSTAYLTSTFQYLELIDVISGLVKATVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVN SSILILISNYLITELLFKV
Uniprot No.

Target Background

Function
This protein may be a component of an ABC transporter complex.
Database Links

KEGG: rty:RT0041

STRING: 257363.RT0041

Protein Families
MlaE permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is RT0041 and what is its predicted function in Rickettsia typhi?

RT0041 is classified as a probable ABC transporter permease protein in Rickettsia typhi. Based on sequence analysis, it functions as part of an ATP-binding cassette (ABC) transport system, likely forming the transmembrane component that creates a channel for substrate passage across the bacterial membrane. The protein contains multiple transmembrane domains consistent with its role as a permease .

The amino acid sequence (mLLNIANLVGKHTIKFAQSVGIFALFSFIAISSIIKPPLYLSLIMRQLLFIGFHSLPVVAMTTFFSGAVLALQSYTGFSRFSAENSIATVVVLSLTRELGPVLAGLIVAGRVGASIAAEIATMKVTEQVDALYTLSTDPIKYLVCPRVIAAIITMPCLVLIGDVIGVMGGYLVGIYKLNFNSTAYLTSTFQYLELIDVISGLVKATVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVNSSILILISNYLITELLFKV) reveals characteristic features of membrane transporters, including hydrophobic regions that likely span the bacterial cell membrane .

How does RT0041 compare structurally to other bacterial ABC transporters?

RT0041 shares structural features with other bacterial ABC transporter permease subunits, including multiple predicted transmembrane helices that form the substrate translocation pathway. The protein consists of 259 amino acids forming a complex transmembrane structure .

When comparing RT0041 to other bacterial ABC transporters, researchers should consider:

  • Transmembrane topology prediction using algorithms such as TMHMM or Phobius

  • Conserved domain analysis to identify signature motifs of ABC transporter permease components

  • Structural modeling based on crystallized ABC transporters from other bacteria

The hydrophobic regions in RT0041 are particularly important for its membrane integration and function, with several potential membrane-spanning domains identified in its sequence .

What experimental approaches are recommended for expressing and purifying recombinant RT0041?

For optimal expression and purification of recombinant RT0041, researchers should consider:

  • Expression system: E. coli-based expression systems have been successfully used for producing this recombinant protein . For membrane proteins like RT0041, specialized E. coli strains designed for membrane protein expression (such as C41/C43) may yield better results.

  • Purification strategy:

    • Inclusion of appropriate detergents for membrane protein solubilization

    • Affinity chromatography using histidine or other fusion tags

    • Size exclusion chromatography for final polishing steps

  • Storage conditions: The protein demonstrates best stability when stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage. Repeated freeze-thaw cycles should be avoided, and working aliquots should be stored at 4°C for up to one week .

  • Quality control: Assess protein purity using SDS-PAGE and verify identity through Western blotting or mass spectrometry.

What is known about the expression profile of RT0041 during Rickettsia typhi infection?

  • Transcriptomic approaches: RT-qPCR targeting RT0041 mRNA from infected cells at various time points post-infection

  • Proteomic approaches: Mass spectrometry analysis of R. typhi proteins during different infection phases

  • Immunological detection: Development of specific antibodies against RT0041 for immunofluorescence or Western blot analysis

Research on R. typhi shows the bacteria can persist in tissues, particularly in the central nervous system, for extended periods even up to a year after initial infection . Understanding RT0041 expression during these different phases of infection would provide valuable insights into its potential role in bacterial persistence.

How might RT0041 contribute to Rickettsia typhi pathogenesis and CNS infection?

RT0041, as an ABC transporter permease protein, may play significant roles in R. typhi pathogenesis through several potential mechanisms:

  • Nutrient acquisition: ABC transporters often facilitate uptake of essential nutrients, potentially enabling bacterial survival in nutrient-limited environments like the CNS.

  • Virulence factor secretion: Some ABC transporters are involved in the export of virulence factors that may contribute to the inflammatory response observed in R. typhi infections.

  • Antimicrobial resistance: ABC transporters can confer resistance by exporting antimicrobial compounds from bacterial cells, potentially contributing to bacterial persistence.

R. typhi infections can lead to severe central nervous system manifestations, including meningoencephalitis . In experimental models, R. typhi has been shown to persist in the brain and cause fatal neurological disorders even months after initial infection . ABC transporters like RT0041 may contribute to this neurotropism and persistence by:

  • Facilitating bacterial adaptation to the CNS microenvironment

  • Supporting nutrient acquisition in this specialized niche

  • Potentially contributing to immune evasion mechanisms

Investigations using C57BL/6 RAG1 -/- mice revealed that R. typhi can persist in the brain for 3-4 months, eventually causing fatal neurological disorders. This was accompanied by massive microglial expansion and neuronal cell death .

What experimental design would best assess the role of RT0041 in R. typhi antibiotic resistance?

To investigate RT0041's potential role in antibiotic resistance, particularly to doxycycline (the drug of choice for R. typhi infections ), researchers should consider:

  • Gene knockout/knockdown studies:

    • CRISPR-Cas9 or antisense RNA approaches to reduce RT0041 expression

    • Assessment of antibiotic susceptibility profiles in wild-type vs. RT0041-deficient strains

  • Antibiotic efflux assays:

    • Fluorescent antibiotic accumulation assays to measure intracellular retention

    • Compare antibiotic accumulation in presence of ABC transporter inhibitors

  • Resistance development monitoring:

    • Serial passage experiments in sub-inhibitory concentrations of antibiotics

    • Monitoring RT0041 expression changes during resistance development

  • Structural modeling and docking:

    • In silico docking studies of doxycycline and other antibiotics with RT0041

    • Identification of potential substrate binding sites

A comprehensive experimental design should include appropriate controls and multiple technical and biological replicates to ensure robust data interpretation.

How can researchers investigate the interaction between RT0041 and host immune components?

Understanding how RT0041 interacts with host immune components is crucial for elucidating R. typhi pathogenesis. Researchers should consider:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation experiments with RT0041 and host cell proteins

    • Yeast two-hybrid screening to identify potential host interactors

    • Surface plasmon resonance to quantify binding affinities

  • Immunological response assessment:

    • Cytokine profiling in cell culture models exposed to purified RT0041

    • Flow cytometric analysis of immune cell activation

    • Investigation of pattern recognition receptor engagement

  • In vivo studies:

    • Administration of purified RT0041 to animal models to assess inflammatory responses

    • Comparison with immune responses during actual R. typhi infection

Research has shown that during R. typhi infection, there is significant immune cell infiltration in the brain, with CD11b+ macrophages harboring the bacteria and expressing inducible nitric oxide synthase (iNOS) . Investigating whether RT0041 plays a role in this specific immune interaction would be valuable.

What methodologies are most appropriate for studying RT0041 structure-function relationships?

To elucidate structure-function relationships of RT0041, researchers should employ:

  • Structural analysis techniques:

    • X-ray crystallography (challenging for membrane proteins but potentially feasible with appropriate detergents or lipidic cubic phase methods)

    • Cryo-electron microscopy for high-resolution structural determination

    • NMR spectroscopy for dynamics studies of specific domains

  • Functional assays:

    • Liposome reconstitution with purified RT0041 for transport studies

    • Substrate binding assays using fluorescent or radiolabeled potential substrates

    • Membrane potential measurements to assess transport activity

  • Mutagenesis approaches:

    • Site-directed mutagenesis of conserved residues identified in the sequence (259 amino acids)

    • Creation of chimeric proteins to identify functional domains

    • Truncation analysis to determine minimal functional units

  • Computational methods:

    • Molecular dynamics simulations to study protein flexibility and substrate interactions

    • Homology modeling based on related ABC transporters with known structures

    • Evolutionary analysis to identify functionally important conserved regions

These complementary approaches can provide insights into how RT0041 structure relates to its function in R. typhi biology and pathogenesis.

What are the challenges and solutions for developing RT0041-targeted therapeutics against R. typhi infections?

Developing therapeutics targeting RT0041 presents several challenges:

  • Challenges:

    • Limited structural information on RT0041

    • Potential functional redundancy with other transporters

    • Ensuring specificity against bacterial transporters versus human homologs

    • Difficulty in delivering inhibitors across host cell membranes to reach intracellular bacteria

  • Potential solutions:

    • Structure-based drug design using computational modeling

    • High-throughput screening of compound libraries against purified RT0041

    • Development of adjuvant therapies to enhance doxycycline efficacy

    • Exploration of molecular mechanisms behind doxycycline resistance development

The current treatment of choice for R. typhi infections is doxycycline, which demonstrates superior efficacy compared to alternatives like azithromycin . Understanding potential interactions between doxycycline and ABC transporters like RT0041 could lead to improved therapeutic strategies, particularly for severe cases involving CNS manifestations.

What protocols are recommended for detecting RT0041 expression in clinical samples?

For detecting RT0041 expression in clinical samples from patients with suspected R. typhi infection, researchers should consider:

  • Nucleic acid-based detection:

    • RT-qPCR targeting RT0041 mRNA

    • Digital PCR for absolute quantification in low-abundance samples

    • RNA in situ hybridization for tissue localization

  • Protein-based detection:

    • Development of specific antibodies against RT0041 for immunohistochemistry

    • Targeted proteomics using selected reaction monitoring (SRM) mass spectrometry

    • Western blotting of tissue lysates

  • Sample processing considerations:

    • Optimal fixation methods for preserving RNA and protein integrity

    • Microdissection techniques for isolating infected areas

    • Controls to assess specificity against other rickettsial species

When examining CNS samples, special attention should be paid to the microglial and macrophage populations, as research shows these are key sites of R. typhi persistence .

How can researchers assess the substrate specificity of RT0041?

Determining the substrate specificity of RT0041 is crucial for understanding its biological function. Researchers should consider:

  • Transport assays:

    • Reconstitution of purified RT0041 into proteoliposomes

    • Radiolabeled or fluorescently labeled substrate uptake studies

    • Competition assays with potential substrates

  • Binding studies:

    • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

    • Surface plasmon resonance (SPR) for binding kinetics

    • Fluorescence-based ligand binding assays

  • Comparative genomics:

    • Analysis of RT0041 homologs in related species with known substrate preferences

    • Identification of substrate-binding motifs through sequence alignment

    • Phylogenetic analysis to infer functional relationships

  • Metabolomic approaches:

    • Comparative metabolite profiling of wild-type versus RT0041-deficient bacteria

    • Identification of accumulated or depleted metabolites as candidate substrates

These approaches should be integrated with structural information to develop a comprehensive understanding of RT0041 substrate specificity.

What are the recommended controls for experiments involving recombinant RT0041?

Proper experimental controls are essential for research involving recombinant RT0041:

  • Protein quality controls:

    • Verification of protein identity by mass spectrometry

    • Assessment of proper folding using circular dichroism

    • Size exclusion chromatography to confirm oligomeric state

    • Negative controls using denatured protein preparations

  • Functional assay controls:

    • Known ABC transporter inhibitors as positive controls

    • Mutated versions of RT0041 (e.g., Walker A/B motif mutations)

    • Related ABC transporters with distinct substrate specificity

    • Background subtraction from empty vectors or irrelevant proteins

  • Expression system controls:

    • Empty vector controls processed identically to RT0041-expressing constructs

    • Housekeeping gene analysis for normalization in expression studies

    • Verification of protein localization in membrane fractions

When working with the commercially available recombinant protein, researchers should verify batch consistency and conduct functional tests before proceeding with complex experiments .

How can researchers establish relevant in vitro models to study RT0041 function during infection?

Developing appropriate in vitro models for studying RT0041 function during R. typhi infection requires careful consideration:

  • Cell culture models:

    • Endothelial cell lines (primary target of R. typhi infection )

    • Microglial cell cultures (relevant for CNS manifestations )

    • Macrophage cell lines (harbor R. typhi in CNS infections )

  • Infection protocols:

    • Culture of R. typhi in L929 mouse fibroblasts as described in the literature

    • Standardized infection ratios and growth conditions

    • Time-course studies to capture different infection phases

  • RT0041 manipulation strategies:

    • Gene silencing approaches (if feasible in R. typhi)

    • Overexpression systems to assess gain-of-function effects

    • Addition of purified recombinant RT0041 to study direct effects

  • Readout systems:

    • Bacterial load quantification by qPCR targeting the prsA gene

    • Immunofluorescence visualization of bacteria

    • Host cell response measurements (cytokine production, cell death)

The ability of R. typhi to infect and persist in mouse brain tissue provides a foundation for developing more sophisticated in vitro models that recapitulate aspects of CNS infection .

How should researchers interpret phenotypic changes in RT0041 mutants compared to wild-type R. typhi?

When analyzing phenotypic differences between RT0041 mutants and wild-type R. typhi, researchers should consider:

  • Growth characteristics:

    • Growth curves in standard media versus nutrient-limited conditions

    • Competition assays between mutant and wild-type strains

    • Stress response profiles (pH, temperature, oxidative stress)

  • Virulence assessment:

    • Invasion efficiency in relevant cell types

    • Intracellular replication rates

    • Cytopathic effects on host cells

    • In vivo infection dynamics in animal models

  • Statistical considerations:

    • Appropriate statistical tests for comparing phenotypic differences

    • Multiple testing corrections for large datasets

    • Effect size calculations to determine biological significance

    • Power analysis to ensure adequate sample sizes

  • Complementation controls:

    • Rescue experiments with wild-type RT0041 to confirm phenotype specificity

    • Dose-dependent complementation to assess quantitative relationships

When interpreting results, researchers should contextualize findings within the broader understanding of R. typhi pathogenesis, particularly its ability to persist in tissues and cause delayed CNS manifestations .

What challenges exist in distinguishing the specific functions of RT0041 from other ABC transporters in R. typhi?

Differentiating the specific functions of RT0041 from other ABC transporters in R. typhi presents several challenges:

  • Functional redundancy issues:

    • Multiple ABC transporters may have overlapping substrate specificities

    • Compensation mechanisms may mask phenotypes in single knockout studies

    • Evolutionary conservation may indicate essential functions

  • Experimental approaches to address redundancy:

    • Creation of multiple transporter knockout strains

    • Conditional expression systems to regulate multiple transporters

    • Comparative expression analysis across different infection conditions

  • Bioinformatic strategies:

    • Comprehensive annotation of all ABC transporters in R. typhi genome

    • Classification based on predicted substrate specificities

    • Identification of unique structural features of RT0041

  • High-throughput approaches:

    • Transcriptomic profiling to identify co-regulated transporters

    • Metabolomic analysis to map substrate utilization networks

    • Systematic interaction screening for specific binding partners

The compact genome of R. typhi necessitates careful analysis to distinguish the unique functions of RT0041 from other transport systems that may have similar roles in bacterial physiology and pathogenesis.

How can researchers correlate RT0041 function with clinical manifestations of R. typhi infections?

To establish connections between RT0041 function and clinical manifestations of R. typhi infections, researchers should consider:

  • Translational research approaches:

    • Analysis of RT0041 expression in patient samples stratified by disease severity

    • Correlation of RT0041 sequence variants with clinical outcomes

    • Development of RT0041-based diagnostic markers

  • Animal model studies:

    • Comparison of wild-type and RT0041-modified R. typhi in animal infection models

    • Focus on CNS manifestations, given the neurotropism of R. typhi

    • Correlation of bacterial persistence with RT0041 expression levels

  • Clinical correlation data:

    • Cerebrospinal fluid analysis in patients with R. typhi meningoencephalitis

    • Investigation of RT0041 expression in different clinical phases

    • Comparison between uncomplicated cases and those with CNS involvement

R. typhi infections can progress to serious CNS manifestations, including meningoencephalitis, characterized by pleocytosis and low CSF/serum glucose ratios . Understanding how RT0041 might contribute to these specific manifestations could provide valuable clinical insights.

What methodological considerations are important when analyzing RT0041 expression data across different experimental conditions?

When analyzing RT0041 expression data across various experimental conditions, researchers should consider:

  • Reference gene selection:

    • Identification of stably expressed housekeeping genes for normalization

    • Validation of reference genes across all experimental conditions

    • Use of multiple reference genes for robust normalization

  • Statistical analysis approaches:

    • Appropriate transformation of expression data if not normally distributed

    • Mixed-effects models for repeated measures designs

    • Multiple testing corrections for genome-wide expression analyses

  • Validation strategies:

    • Confirmation of key findings using independent methods (RT-qPCR, Western blot)

    • Single-cell approaches to assess expression heterogeneity

    • Spatial localization of expression using in situ techniques

  • Contextual interpretation:

    • Integration with other omics data (proteomics, metabolomics)

    • Pathway analysis to identify co-regulated genes

    • Temporal dynamics analysis for infection time-course studies

The specific detection of R. typhi gene expression can be performed using established methods like qPCR targeting specific genes such as prsA, as described in the literature .

What are the most promising research directions for understanding RT0041's role in R. typhi virulence and persistence?

Future research on RT0041 should prioritize:

  • Structure-function relationships:

    • High-resolution structural determination of RT0041

    • Identification of critical domains for substrate binding and transport

    • Elucidation of regulatory mechanisms controlling RT0041 activity

  • Host-pathogen interactions:

    • Investigation of RT0041's potential role in immune evasion

    • Assessment of RT0041 as an immunogenic target

    • Exploration of interactions with host cell machinery

  • CNS infection mechanisms:

    • RT0041's potential contribution to blood-brain barrier crossing

    • Role in supporting bacterial survival in CNS microenvironment

    • Connection to the observed persistence in brain macrophages and microglia

  • Therapeutic targeting:

    • Development of specific inhibitors targeting RT0041

    • Evaluation as a potential vaccine component

    • Exploration of synergistic effects with current antibiotics like doxycycline

Understanding how RT0041 contributes to the persistent infections described in animal models, where R. typhi can be recultivated from tissues up to a year after infection , represents a particularly promising research direction.

How might systems biology approaches advance our understanding of RT0041 in the context of R. typhi pathogenesis?

Systems biology approaches offer powerful tools for contextualizing RT0041 function:

  • Multi-omics integration:

    • Correlation of transcriptomics, proteomics, and metabolomics data

    • Network analysis to position RT0041 within bacterial physiological pathways

    • Identification of condition-specific regulation patterns

  • Host-pathogen interaction networks:

    • Modeling of bacterial-host protein interaction networks

    • Analysis of RT0041's position within these networks

    • Prediction of critical nodes for therapeutic intervention

  • Mathematical modeling:

    • Flux balance analysis incorporating RT0041 transport functions

    • Agent-based models of infection dynamics

    • Pharmacokinetic/pharmacodynamic modeling for drug development

  • Comparative systems analysis:

    • Cross-species comparison with other Rickettsia ABC transporters

    • Evolutionary analysis to identify conserved functional modules

    • Identification of unique adaptations in R. typhi

These approaches can help contextualize the role of RT0041 within the broader framework of R. typhi pathophysiology, particularly its neurotropism and ability to establish persistent infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.