Recombinant Rickettsia typhi Probable intracellular septation protein A (RT0380)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Kindly consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. We recommend storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; RT0380; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Target Names
RT0380
Target Protein Sequence
MLKLLSEIGPVIAFFAGFFYGGGIQSATLYMLITSIICITLCYIIDKKVSKLSIISSTVL FVSGIITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKYALESIVRLKEESWIIL SYRTAAFFFFMAVVNEVVWRNFSDETWVKFKVFGVIPITFIFILLQLPLLLKNKLPDSKI
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: rty:RT0380

STRING: 257363.RT0380

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is RT0380 and what is its functional role in Rickettsia typhi?

RT0380 is identified as a "putative intracellular septation protein" in Rickettsia typhi str. Wilmington. Based on its functional classification under "Cell cycle control, mitosis and meiosis," this protein likely plays a crucial role in bacterial cell division processes . The temperature-regulated nature of RT0380, showing a fold change of 0.6 across three experiments, suggests its expression is reduced at higher temperatures, which may reflect adaptation to different host environments during the Rickettsia lifecycle.

Methodologically, researchers investigating RT0380's function should conduct comparative genomic analyses with known bacterial septation proteins, generate knockout strains if possible, and perform localization studies during cell division cycles to confirm its role in septation.

How does RT0380 expression respond to temperature changes?

According to genome-wide screening data, RT0380 exhibits a fold change of 0.6 (with individual experimental values of 0.4, 0.9, and 0.6) in response to temperature shifts . This consistent pattern of downregulation at higher temperatures suggests that this septation protein may be more abundantly expressed at lower temperatures, potentially corresponding to conditions in arthropod vectors rather than mammalian hosts.

When studying this temperature-dependent regulation, researchers should employ quantitative RT-PCR validation, western blotting for protein-level confirmation, and conduct temperature-shift time course experiments to determine the kinetics of expression changes. These approaches will help establish whether the regulation occurs at transcriptional, post-transcriptional, or protein stability levels.

What is the genomic context of RT0380 in the Rickettsia typhi genome?

While complete genomic context information is not provided in the search results, RT0380 is part of the Rickettsia typhi str. Wilmington genome and categorized under cell cycle control functions . For thorough analysis, researchers should examine adjacent genes to determine if RT0380 is part of an operon structure with other cell division genes, perform promoter analysis to identify regulatory elements responsive to temperature, and compare synteny across related Rickettsia species to assess evolutionary conservation of this genomic region.

What are recommended protocols for recombinant expression of RT0380?

For successful recombinant expression of RT0380, researchers should implement the following methodological approach:

  • Gene synthesis optimization with codon usage adjusted for expression host

  • Vector selection incorporating solubility-enhancing tags (MBP, SUMO, or GST)

  • Expression trials in multiple E. coli strains (BL21(DE3), Arctic Express, Rosetta)

  • Temperature gradient testing (16°C, 25°C, 30°C, 37°C) with particular attention to lower temperatures, given RT0380's natural downregulation (fold change 0.6) at higher temperatures

  • Induction optimization with varying IPTG concentrations (0.1-1.0 mM)

  • Solubility assessment and membrane fraction analysis, as septation proteins often associate with membranes

  • Purification strategy combining affinity chromatography and size exclusion methods

Given the temperature-regulated nature of the native protein, expression at lower temperatures (16-25°C) may better preserve the protein's natural conformation and activity.

How can researchers evaluate RT0380's role in bacterial septation experimentally?

To evaluate RT0380's role in bacterial septation, researchers should employ a multi-faceted experimental approach:

  • Genetic manipulation: Create conditional knockdown or depletion strains of RT0380 and observe effects on cell division using time-lapse microscopy

  • Localization studies: Generate fluorescently tagged RT0380 to track its dynamic localization during the cell division cycle

  • Protein-protein interaction analysis: Identify interaction partners through co-immunoprecipitation or bacterial two-hybrid screening, focusing on known septation proteins

  • Ultrastructural analysis: Employ electron microscopy to examine septation defects in cells with altered RT0380 expression

  • Temperature-shift experiments: Compare septation processes at different temperatures, correlating with the observed fold change of 0.6

  • In vitro reconstitution: Attempt to reconstruct septation complexes using purified components including RT0380

These approaches should be integrated to build a comprehensive understanding of RT0380's specific role in the septation process.

What approaches are effective for studying temperature-dependent regulation of RT0380?

Given RT0380's temperature-regulated expression pattern (fold change 0.6), researchers should employ these methodological approaches:

  • Transcriptional analysis: Perform reporter gene assays with the RT0380 promoter region at different temperatures

  • mRNA stability assessment: Measure RT0380 transcript half-life at different temperatures using transcription inhibition and time-course sampling

  • Proteomics approach: Quantify RT0380 protein levels across a temperature gradient using targeted mass spectrometry

  • Regulatory element identification: Conduct promoter deletion and mutation analysis to identify temperature-responsive elements

  • Regulatory factor identification: Perform DNA-protein interaction studies to identify transcription factors that bind the RT0380 promoter in a temperature-dependent manner

  • Comparative genomics: Analyze temperature-dependent expression of RT0380 homologs across different Rickettsia species adapted to various host environments

These approaches will help determine the molecular mechanisms underlying the observed temperature regulation (fold change 0.6 across experiments) .

How does RT0380 compare to other temperature-regulated genes in Rickettsia typhi?

Based on the genome-wide screen data, RT0380 (fold change 0.6) can be compared with other temperature-regulated genes to identify potential functional relationships:

Functional CategoryGeneFold ChangePossible Functional Relationship
Cell cycle controlRT03800.6Putative intracellular septation protein
Energy productionRT02610.5Complex III (mitochondrial electron transport)
Energy productionRT03450.6NADH dehydrogenase beta subunit
TranslationRT06380.530S ribosomal protein S14
TranscriptionRT01290.5DNA-directed RNA polymerase beta subunit
ReplicationRT07060.4DNA ligase

The similar downregulation patterns observed across these diverse functional categories suggest that RT0380 is part of a coordinated temperature-response network . This coordinated regulation may represent an adaptation strategy where Rickettsia typhi modulates cell division along with metabolism and protein synthesis during transitions between arthropod vectors and mammalian hosts.

What structural and functional domains would be expected in RT0380?

While specific structural information for RT0380 is not provided in the search results, as a putative intracellular septation protein, researchers would expect to find several conserved domains:

  • Membrane-binding domains: Potentially amphipathic helices or transmembrane segments that localize the protein to the division site

  • Peptidoglycan interaction domains: Motifs that recognize and bind bacterial cell wall components

  • Protein-protein interaction domains: Regions that mediate interactions with other divisome components

  • Potential enzymatic domains: Such as transpeptidase, transglycosylase, or hydrolase activities involved in septum formation

Researchers should employ bioinformatic approaches including HMMER, Pfam, and InterPro searches to identify these domains, followed by targeted mutagenesis to verify their functional significance. Structure prediction algorithms like AlphaFold would provide additional insights into domain organization and possible mechanisms.

How might the temperature-regulation of RT0380 contribute to Rickettsia typhi's host adaptation?

The temperature-dependent regulation of RT0380 (fold change 0.6) likely represents an important adaptation mechanism as Rickettsia typhi transitions between arthropod vectors (~25°C) and mammalian hosts (~37°C) . This downregulation at higher temperatures could contribute to host adaptation through several mechanisms:

  • Cell division rate modulation: Reduced septation protein expression may slow division rates in mammalian hosts, favoring persistence over rapid proliferation

  • Morphological adaptations: Changes in septation dynamics could alter cell size or shape in a host-appropriate manner

  • Resource allocation: Downregulation of division machinery could redirect energy toward other processes more critical in mammalian hosts

  • Immune evasion: Modified cell division patterns might minimize exposure of pathogen-associated molecular patterns (PAMPs)

Researchers investigating this hypothesis should compare growth kinetics, cell morphology, and host immune responses between wild-type bacteria and strains engineered to express RT0380 at constant levels regardless of temperature.

How should researchers interpret the variability in RT0380 fold change values (0.4, 0.9, 0.6) across experiments?

The fold change values for RT0380 across three experiments (0.4, 0.9, 0.6) show notable variability that requires careful interpretation . The average fold change of 0.6 indicates consistent downregulation at higher temperatures, but the range of values suggests several important considerations:

  • Biological variability: The temperature response may be influenced by other factors such as growth phase or media composition

  • Technical variability: Differences in experimental conditions or measurement techniques could contribute to the observed range

  • Threshold effects: The second experiment (0.9) approaches a fold change of 1.0, suggesting conditions where regulation may be less pronounced

Methodologically, researchers should address this variability by:

  • Performing additional biological replicates with standardized conditions

  • Validating microarray/RNA-seq findings with quantitative RT-PCR

  • Conducting protein-level measurements to confirm transcriptional changes translate to altered protein abundance

  • Investigating potential environmental or physiological factors that might modulate the temperature response

What challenges might researchers face when working with recombinant RT0380?

Researchers working with recombinant RT0380 should anticipate several technical challenges:

  • Solubility issues: As a putative septation protein, RT0380 may have membrane-interacting domains that could cause aggregation during recombinant expression

  • Proper folding: The temperature-regulated nature of RT0380 (fold change 0.6) suggests its structure may be temperature-sensitive, potentially affecting folding during expression

  • Functional assessment: Without clearly defined biochemical activity, confirming the functionality of purified recombinant RT0380 will be challenging

  • Structural studies: Septation proteins often contain flexible regions that can complicate crystallization or structural determination

  • Post-translational modifications: Any native modifications required for RT0380 function may be absent in heterologous expression systems

To address these challenges, researchers should employ multiple expression systems, optimize buffer conditions, use various solubility-enhancing tags, and develop activity assays based on predicted functions such as protein-protein interactions or membrane binding.

How might RT0380 function differ between in vitro studies and in vivo infections?

The function of RT0380 observed in in vitro studies may differ significantly from its role during actual host infections due to several factors:

  • Temperature regulation: The demonstrated fold change of 0.6 indicates temperature responsiveness that may be difficult to fully recapitulate in vitro

  • Host-pathogen interactions: Factors from host cells may modulate RT0380 function during infection

  • Microenvironment conditions: The intracellular environment provides unique conditions (pH, ion concentrations, osmolarity) that affect protein function

  • Temporal dynamics: Expression timing during the infection cycle may influence RT0380's role

  • Protein interaction networks: The complete set of interaction partners present during infection may not be available in simplified in vitro systems

Researchers should address these differences by:

  • Comparing results between cell-free systems, cell culture models, and animal infection models

  • Developing cell culture systems that mimic temperature transitions between vector and mammalian hosts

  • Using techniques like in vivo crosslinking to capture native protein interactions during infection

  • Employing stage-specific gene expression systems to control timing of RT0380 expression

How could RT0380 be exploited as a potential antimicrobial target?

RT0380, as a putative intracellular septation protein, represents a potential antimicrobial target through several strategic approaches:

  • Target validation: First establish essentiality through conditional knockdown systems, determining whether RT0380 is required for Rickettsia typhi viability or virulence

  • High-throughput screening: Develop assays based on RT0380's predicted functions (protein-protein interactions, membrane binding) to identify inhibitory compounds

  • Structure-guided drug design: Solve the three-dimensional structure of RT0380 to identify druggable pockets for rational inhibitor design

  • Peptide inhibitors: Design peptide mimetics that disrupt essential interactions between RT0380 and other septation proteins

  • Temperature-sensitive targeting: Leverage the natural temperature regulation (fold change 0.6) to design compounds that selectively target RT0380 at mammalian host temperatures

The development of such strategies would need to account for the intracellular lifestyle of Rickettsia typhi and include appropriate delivery mechanisms to reach the bacteria within host cells.

What approaches could elucidate the complete regulatory network controlling RT0380 expression?

To comprehensively characterize the regulatory network controlling RT0380's temperature-dependent expression (fold change 0.6) , researchers should pursue these methodological approaches:

  • Promoter analysis: Perform sequential deletions and site-directed mutagenesis of the RT0380 promoter region to identify critical regulatory elements

  • Transcription factor identification: Use techniques such as DNA-affinity chromatography or yeast one-hybrid screens to identify proteins that bind to the RT0380 promoter

  • Global regulatory networks: Apply network analysis to transcriptomic data to identify master regulators that control multiple temperature-responsive genes including RT0380

  • Small RNA interactions: Investigate potential post-transcriptional regulation by small RNAs using techniques like CLASH (crosslinking, ligation, and sequencing of hybrids)

  • Epigenetic regulation: Assess whether DNA methylation or other epigenetic mechanisms contribute to temperature-dependent expression

  • Signaling pathways: Characterize temperature sensing and signal transduction pathways that ultimately regulate RT0380 expression

Integration of these approaches would provide a comprehensive understanding of how RT0380 expression is fine-tuned in response to environmental temperature changes.

How might systems biology approaches enhance our understanding of RT0380 in Rickettsia pathogenesis?

Systems biology approaches could provide comprehensive insights into RT0380's role within the broader context of Rickettsia typhi pathogenesis:

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data across temperature conditions to place RT0380 (fold change 0.6) within broader adaptive networks

  • Protein-protein interaction networks: Map the complete interactome of RT0380 to understand its position within the cell division machinery and potential moonlighting functions

  • Computational modeling: Develop predictive models of how altered RT0380 expression affects bacterial division rates and population dynamics during infection

  • Comparative genomics: Analyze RT0380 conservation and regulation across different Rickettsia species with varied host preferences and virulence profiles

  • Host-pathogen interface modeling: Investigate how RT0380-mediated changes in bacterial physiology affect interactions with host cellular mechanisms

  • Evolutionary analysis: Study the selective pressures that have shaped RT0380 sequence and regulation across the Rickettsiales order

These integrative approaches would help contextualize RT0380's function within the complex adaptive strategies employed by Rickettsia typhi during its lifecycle across different host environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.