Recombinant Rickettsia typhi Protein-export membrane protein SecG (secG)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rickettsia typhi Protein-export Membrane Protein SecG (secG)

Recombinant Rickettsia typhi SecG is a membrane-associated protein critical to the Sec-dependent protein secretion pathway in Gram-negative bacteria. As part of the SecYEG translocon, SecG facilitates the transport of preproteins across the inner membrane and their integration into the lipid bilayer. While SecG is not essential for bacterial viability, its absence in E. coli leads to translocation defects, underscoring its role in optimizing secretion efficiency . In Rickettsia typhi, SecG is produced recombinantly for research applications, including studies on bacterial secretion mechanisms and diagnostic assays .

Mechanism of Action

The SecYEG translocon operates as a dynamic channel for protein export. SecG stabilizes the SecYEG complex, particularly during the insertion of signal peptides into the lipid bilayer . Key interactions include:

  • SecY: Forms the core pore with SecE, while SecG modulates its conformational flexibility.

  • SecA: ATPase-driven motor that binds to SecY and facilitates preprotein translocation .

In Rickettsia, SecG likely collaborates with SecA and SecY to export virulence factors and housekeeping proteins. While Rickettsia SecA cannot complement E. coli SecA mutants, chimeric constructs (e.g., Rickettsia N-terminal + E. coli C-terminal domains) restore functionality, highlighting species-specific interactions .

Recombinant SecG in Serological Studies

Recombinant SecG is utilized in ELISA-based assays to detect Rickettsia typhi infections. Though not a primary immunodominant antigen (unlike OmpB or GroEL), SecG may serve as a complementary diagnostic tool .

ApplicationUse Case
ELISA AntigenDetection of anti-Rickettsia antibodies in patient sera
Structural StudiesCrystallization or cryo-EM to resolve SecYEG complex interactions
Functional AssaysReconstitution of SecYEG activity in in vitro translocation systems

Challenges in Functional Complementation

Full-length Rickettsia SecA and SecG proteins fail to restore secretion in E. coli mutants, indicating divergence in translocon compatibility . This species-specificity complicates cross-functional studies but highlights the evolutionary adaptation of secretion systems in obligate intracellular pathogens like Rickettsia .

SecG Across Bacterial Species

SpeciesEssentialityRole in TranslocationInteraction Partners
E. coliNon-essentialStabilizes SecYEG; facilitates lipid integrationSecY, SecE, SecDF
Rickettsia typhiNon-essentialPresumed similar to E. coli; species-specific interactionsSecY, SecA, SecE
Bacillus subtilisNon-essentialEnhances translocation efficiency; similar to E. coliSecY, SecA

In Rickettsia, SecG’s absence may lead to impaired secretion of surface antigens (e.g., Sca proteins), which are critical for host cell invasion .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
secG; RT0053; Protein-export membrane protein SecG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Target Names
secG
Target Protein Sequence
MLDILLFVHITISILLIIVILMQRSGSGGISGISGDNNMGVVSAKTVGNFLSKSTIILTT LFLINAIILANLSSKKKSNLVSKINEIEENQTDNSLPIAK
Uniprot No.

Target Background

Function
SecG is involved in protein export and participates in an early step of protein translocation.
Database Links

KEGG: rty:RT0053

STRING: 257363.RT0053

Protein Families
SecG family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of SecG in the Sec translocon of Rickettsia typhi?

SecG functions as an integral membrane protein component of the Sec translocon complex in R. typhi, forming part of the core channel (SecYEG) responsible for translocating unfolded proteins across the bacterial cytoplasmic membrane. While SecY forms the actual channel and SecE provides structural stability, SecG enhances the efficiency of protein translocation, particularly under stressful environmental conditions.

In R. typhi specifically, the Sec pathway facilitates the export of various proteins that contribute to virulence and intracellular survival. While many secreted proteins in R. typhi utilize dedicated secretion systems, recent research suggests some rickettsial proteins employ non-canonical secretion mechanisms that involve both the Sec translocon and other pathways. For example, studies have shown that "an ankyrin domain-containing protein of Rickettsia spp. is exported extracellularly via a non-canonical secretion pathway that utilizes both the Sec translocon and TolC" . This indicates SecG may participate in hybrid secretion pathways that are particularly important for this obligate intracellular pathogen.

How does the expression of secG vary during R. typhi infection?

While specific studies on secG expression patterns throughout R. typhi infection cycles remain limited, insights can be drawn from research on other rickettsial secretion-related genes. For instance, the RT0218 gene encoding the ankyrin repeat protein RARP-1 shows "differential transcript abundance at various phases of R. typhi intracellular growth" , suggesting temporal regulation of genes involved in protein secretion and processing.

To investigate secG expression, quantitative RT-PCR methodology similar to that used for other rickettsial genes would be appropriate. This would involve:

  • RNA extraction from R. typhi at defined time points post-infection

  • Reverse transcription to generate cDNA

  • Amplification using secG-specific primers

  • Normalization against housekeeping genes such as rpsL (RT0119)

  • Analysis using efficiency-corrected threshold cycle (CT) values

The PCR conditions would typically include "reverse transcription at 50°C for 30 min and then at 95°C for 10 min; 40 cycles of 95°C for 15 s, 55°C for 15 s, and 72°C for 30 s" . Expression data would then be analyzed using appropriate software tools with amplification efficiency correction.

What methods can confirm SecG localization in R. typhi?

Determining the subcellular localization of SecG requires multiple complementary approaches:

  • Cellular fractionation: Similar to techniques used for other rickettsial proteins, infected cells can be separated into distinct fractions. As demonstrated for Pat1 and Pat2 proteins, "pellet and supernatant fractions from uninfected or R. typhi-infected Vero76 cells" can be prepared and analyzed . The pellet would contain intact rickettsiae and host cell debris, while the supernatant would contain soluble proteins.

  • Western blotting: Fractions can be probed with anti-SecG antibodies, alongside controls including:

    • GAPDH (host cytoplasmic protein)

    • EF-Ts (rickettsial cytoplasmic protein)

    • Rickettsial outer membrane proteins (like rOmpB)

  • Immunofluorescence microscopy: This technique can visualize SecG localization within R. typhi or in infected host cells, similar to the approach used for Pat1 and Pat2 where researchers showed that the proteins "are co-localized with R. typhi, and also form punctate structures throughout the host cell cytoplasm" .

  • Protease protection assays: To distinguish between periplasmic and cytoplasmic localization.

  • Immunoelectron microscopy: For high-resolution localization studies.

These approaches would confirm whether SecG remains exclusively membrane-associated or if it exhibits more complex localization patterns during the R. typhi intracellular lifecycle.

How does the Sec pathway interact with other secretion systems in R. typhi?

Research has revealed intriguing connections between the Sec pathway and other secretion systems in R. typhi, particularly the TolC-dependent secretion pathway. Studies indicate that certain rickettsial proteins utilize hybrid secretion mechanisms that incorporate components from multiple canonical secretion systems.

A prime example is the secretion of ankyrin repeat proteins. Research demonstrated that "an ankyrin domain-containing protein of Rickettsia spp. is exported extracellularly via a non-canonical secretion pathway that utilizes both the Sec translocon and TolC" . This suggests a functional connection between the Sec pathway (which includes SecG) and TolC, a component typically associated with type I secretion systems.

The mechanism likely involves initial translocation of proteins across the inner membrane via the Sec pathway, followed by TolC-mediated export across the outer membrane. Evidence for this hypothesis comes from the RARP-1 protein (encoded by RT0218) in R. typhi, which is "secreted by R. typhi into the host cytoplasm during in vitro infection of mammalian cells" . Importantly, transcriptional analysis revealed that "RT0218 was cotranscribed with adjacent genes RT0217 (hypothetical protein) and RT0216 (TolC) as a single polycistronic mRNA" , providing strong evidence for functional linkage between these components.

To further investigate these interactions, approaches could include:

  • Co-immunoprecipitation to detect physical interactions

  • Transcriptional analysis of co-regulated genes

  • Surrogate host studies with components from both pathways

  • Mutational analyses of potential interaction sites

What role does SecG play in virulence factor secretion in R. typhi?

While the specific contribution of SecG to virulence factor secretion in R. typhi has not been directly characterized, several lines of evidence suggest its importance:

  • Surface protein translocation: Many bacterial virulence factors that interact with host cells must first cross the cytoplasmic membrane, often via the Sec pathway. In R. typhi, patatin phospholipases Pat1 and Pat2 are "rickettsial surface exposed proteins" that contribute to pathogenesis by facilitating bacterial entry and phagosomal escape.

  • Non-canonical secretion pathways: The discovery that R. typhi utilizes hybrid secretion mechanisms involving the Sec translocon suggests SecG may play a role in the initial steps of virulence factor export. The RARP-1 protein, which is secreted in a TolC-dependent manner, may initially require the Sec pathway for translocation across the inner membrane.

  • Membrane protein insertion: SecG also participates in the insertion of membrane proteins, which may include various transporters and receptors that contribute to rickettsial virulence by mediating nutrient acquisition or host-pathogen interactions.

Antibody inhibition studies provide compelling evidence for the importance of secreted proteins in R. typhi pathogenesis. Research demonstrated that "pretreatment of R. typhi by anti-Pat1 or anti-Pat2 antibody blocked R. typhi infection of host cells and also blocked or delayed rickettsial phagosome escape" . Similar approaches targeting SecG could help elucidate its specific contributions to virulence factor secretion.

What is the evidence for Sec-TolC cooperation in protein secretion?

Multiple experimental findings support the cooperation between Sec and TolC pathways in rickettsial protein secretion:

  • Co-transcription of secretion components: Transcriptional analysis revealed that "RT0218 was cotranscribed with adjacent genes RT0217 (hypothetical protein) and RT0216 (TolC) as a single polycistronic mRNA" . This genetic linkage suggests functional relationship between these components.

  • Complementation studies: When expressing rickettsial proteins in surrogate hosts, researchers found that "expression of R. typhi tolC in the E. coli tolC mutant restored the secretion of RARP-1" , demonstrating the specificity of the TolC component in this secretion pathway.

  • Secretion assays in E. coli: When investigating RARP-1 secretion, researchers discovered that "deletion of either the N-terminal signal peptide or the C-terminal ankyrin repeats abolished RARP-1 secretion by wild-type E. coli" . This indicates that both classical secretion signals (potentially recognized by the Sec system) and specific structural domains are required for efficient secretion.

  • Direct experimental evidence: Studies explicitly state that "an ankyrin domain-containing protein of Rickettsia spp. is exported extracellularly via a non-canonical secretion pathway that utilizes both the Sec translocon and TolC" , presenting a clear model for cooperation between these systems.

This cooperation makes biological sense, as the Sec system specializes in translocating proteins across the inner membrane, while TolC provides a conduit through the outer membrane. Together, they could form a hybrid secretion mechanism adapted to the specific needs of this obligate intracellular pathogen.

What strategies can overcome challenges in expressing recombinant R. typhi SecG?

Expressing and purifying functional recombinant SecG from R. typhi presents several technical challenges that require specialized strategies:

  • Expression system selection:

    • Specialized E. coli strains (C41/C43(DE3)) engineered for membrane protein expression

    • Yeast systems which may provide a more suitable membrane environment

    • Cell-free expression systems that avoid toxicity issues

    • Inducible expression vectors like the pTrcHis2-TOPO system used successfully for other rickettsial proteins, where "protein expression was induced by the addition of 1 mM isopropyl-beta-d-thiogalactopyranoside (IPTG) at 16°C with incubation overnight"

  • Optimization of expression conditions:

    • Low-temperature induction (16°C) to slow protein synthesis and improve folding

    • Reduced inducer concentration to prevent toxic accumulation

    • Co-expression with chaperones to aid proper folding

  • Fusion tags and constructs:

    • Solubility-enhancing tags (MBP, thioredoxin) at N- or C-terminus

    • Addition of purification tags (His, FLAG) for downstream purification

    • Careful consideration of tag position to avoid interfering with membrane insertion

  • Extraction and purification strategies:

    • Screening multiple detergents for optimal solubilization

    • Utilizing mild detergents like n-dodecyl-β-D-maltoside (DDM)

    • Considering membrane mimetics (nanodiscs, amphipols) for maintaining native structure

    • Two-step purification combining affinity chromatography with size exclusion

  • Functional verification methods:

    • Reconstitution into proteoliposomes

    • Complementation assays in SecG-deficient strains

    • Structural analysis by circular dichroism to confirm proper folding

For recombinant proteins expressed in E. coli, the methodology developed for other rickettsial proteins can be adapted, where "culture supernatants were filtered using a 0.22-μm-pore-size filter, and proteins were precipitated to concentrate the supernatant (100- to 150-fold) using prechilled 20% trichloroacetic acid in acetone" . This approach allows detection of secreted proteins in expression systems.

How can surrogate host systems advance SecG functional studies?

Using surrogate host systems like E. coli provides practical approaches for studying R. typhi SecG function, overcoming limitations imposed by Rickettsia's obligate intracellular lifestyle:

  • Complementation studies:
    R. typhi secG can be expressed in E. coli strains with defective or deleted secG to assess functional complementation. This approach mirrors successful studies where "expression of R. typhi tolC in the E. coli tolC mutant restored the secretion of RARP-1" , demonstrating that rickettsial components can function in E. coli.

  • Secretion assays with reporter proteins:
    Fusion of signal sequences from putative R. typhi Sec-dependent proteins to reporters like alkaline phosphatase can assess SecG function in protein export. This methodology is similar to "E. coli PhoA-based gene fusion assay" mentioned for TolC studies .

  • Co-expression with R. typhi substrate proteins:
    R. typhi SecG can be co-expressed with potential R. typhi secreted proteins in E. coli to determine its role in their secretion. For implementation, genes can be cloned "into pTrcHis2-TOPO vector under the control of the trc promoter" and introduced into appropriate E. coli strains.

  • Chimeric protein studies:
    Constructing chimeric proteins that combine domains from E. coli SecG and R. typhi SecG can identify species-specific functional regions and adaptation to the rickettsial lifecycle.

  • Protein-protein interaction mapping:
    Bacterial two-hybrid systems or co-immunoprecipitation in E. coli can identify interactions between R. typhi SecG and other components of secretion pathways.

  • In vitro translation systems:
    E. coli-derived cell-free systems supplemented with membranes containing R. typhi SecG can assess protein translocation in a controlled environment.

The methodology for protein expression and secretion analysis would follow established protocols where "bacteria were grown overnight at 37°C in LB medium containing appropriate antibiotics. The following day, the culture was diluted in fresh LB medium and grown at 37°C to mid-log phase (optical density at 600 nm [OD600] of ~0.3 to 0.5)" before induction and fraction collection.

What methods can identify proteins that interact with SecG in R. typhi?

Multiple complementary techniques can reveal the SecG interactome in R. typhi:

  • Co-immunoprecipitation (Co-IP):
    Using antibodies against SecG, protein complexes can be precipitated from R. typhi lysates and analyzed by mass spectrometry. This requires generating specific antibodies against R. typhi SecG or using cross-reactive antibodies if available.

  • Bacterial two-hybrid systems:
    Modified for use with rickettsial proteins, these systems can detect direct protein-protein interactions by expressing fusion proteins in E. coli. This approach involves creating fusion constructs between SecG and one domain of a split reporter, while potential interaction partners are fused to the complementary domain.

  • Cross-linking coupled with mass spectrometry:
    Chemical cross-linking can capture transient interactions, with subsequent mass spectrometry analysis identifying cross-linked peptides. This provides insights into the interaction interface and can capture associations that may be lost during conventional co-IP procedures.

  • Proximity-dependent biotin identification (BioID):
    A biotin ligase fused to SecG can biotinylate nearby proteins, which can then be purified using streptavidin and identified by mass spectrometry. This approach captures transient or weak interactions in the native cellular environment.

  • Surface plasmon resonance (SPR):
    This technique can quantitatively measure interactions between purified recombinant SecG and other purified proteins, providing kinetic and affinity data for specific interactions.

  • Split-GFP complementation:
    Fragments of GFP fused to SecG and potential interaction partners can reassemble into a fluorescent complex when the proteins interact, allowing visualization of interactions in living cells.

When studying membrane-embedded SecG, careful consideration must be given to membrane solubilization conditions. For host-pathogen interaction studies, the translocation assay methodology described for RARP-1 can be adapted, where "host cell cytoplasmic and nuclear proteins were isolated using Nuclear and Cytoplasmic Extraction Reagents" and analyzed by Western blotting with appropriate antibodies .

How can bioinformatic approaches enhance SecG functional studies?

Bioinformatic approaches offer powerful tools for studying SecG function in R. typhi, particularly given the experimental challenges with this obligate intracellular pathogen:

These bioinformatic approaches can guide experimental work by generating testable hypotheses about SecG function, structure, and interactions in R. typhi.

What is the potential for targeting SecG in anti-rickettsial therapeutics?

The Sec pathway, including SecG, represents a promising target for novel anti-rickettsial therapies for several reasons:

  • Essential pathway: The Sec system is critical for bacterial viability, making it a valuable antimicrobial target. Inhibitors disrupting SecG function could potentially have bactericidal effects on R. typhi.

  • Virulence factor secretion: SecG likely contributes to the secretion of various virulence factors in R. typhi. Studies have shown that blocking secreted proteins like Pat1 and Pat2 with antibodies "blocked R. typhi infection of host cells and also blocked/delayed phagosomal escapes" , demonstrating the therapeutic potential of targeting secretion pathways.

  • Novel mechanism of action: Current anti-rickettsial therapies primarily target protein synthesis (tetracyclines) or DNA replication (fluoroquinolones). Targeting protein secretion represents a novel mechanism of action that could be effective against resistant strains.

  • Potential approaches include:

    • Structure-based drug design targeting SecG-specific features

    • High-throughput screening for small molecule inhibitors

    • Peptide inhibitors mimicking SecG interaction domains

    • Antibody-based approaches targeting exposed regions of SecG or SecG-dependent substrates

Challenges include:

  • Selectivity concerns due to conservation of the Sec pathway across bacteria

  • Intracellular delivery requirements

  • Potential for resistance development

  • Technical challenges in drug discovery against membrane proteins

The approach of targeting secreted virulence factors has conceptual validation in studies showing that "antibody-pretreatment of R. typhi blocked/delayed phagosomal escapes" , suggesting interruption of protein secretion or function can significantly impact infection progress.

How does SecG contribute to R. typhi's adaptation to its intracellular lifestyle?

SecG likely plays multifaceted roles in R. typhi's adaptation to intracellular life:

  • Host cell invasion: SecG may facilitate secretion of proteins involved in initial host cell attachment and entry. Studies have demonstrated that "pretreatment of R. typhi by anti-Pat1 or anti-Pat2 antibody blocked R. typhi infection of host cells" , indicating that secreted proteins are crucial for invasion.

  • Phagosomal escape: After internalization, R. typhi must escape from the phagosome to access the cytoplasm for replication. Antibody pretreatment against Pat1 or Pat2 "blocked or delayed rickettsial phagosome escape" , suggesting SecG-dependent export of such factors is critical for this key stage of infection.

  • Effector protein secretion: Throughout infection, R. typhi must secrete various effector proteins that modulate host cell processes. Proteins like RARP-1 are "secreted by R. typhi into the host cytoplasm during in vitro infection" and may utilize SecG-dependent steps in their secretion.

  • Membrane protein insertion: SecG participates in the insertion of membrane proteins that may function as transporters for nutrient acquisition from the host cytoplasm, critical for an organism that has undergone reductive evolution and lacks many biosynthetic pathways.

  • Stress adaptation: The rickettsial intracellular environment presents various stresses, and SecG may be particularly important under these conditions, as it enhances translocation efficiency especially under stress in other bacterial systems.

The expression and activity of SecG and other secretion components likely varies throughout the intracellular cycle, similar to findings that certain rickettsial genes show "differential transcript abundance at various phases of R. typhi intracellular growth" . This temporal regulation would allow appropriate allocation of resources during different infection stages.

Understanding SecG's contribution to intracellular adaptation could reveal new targets for therapeutic intervention in rickettsial diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.