Recombinant Rickettsia typhi Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Overview of the Sec-Dependent Secretion Pathway in Rickettsia typhi

The Sec translocon is essential for protein secretion in bacteria, facilitating the transport of preproteins across the cytoplasmic membrane. Key components include:

  • SecA: An ATPase that drives translocation through ATP hydrolysis .

  • SecD, SecF, SecY, and other integral membrane proteins: These form the translocation channel .

While Rickettsia genomes encode homologs of SecD, functional studies on this specific subunit in R. typhi are absent in the literature. Research has instead focused on SecA and other Sec-related proteins.

SecA

  • Structure: The N-terminal ATPase domain is conserved, but the C-terminal domain is species-specific .

  • Functional Complementation: Full-length R. typhi SecA failed to rescue E. coli SecA mutants, but chimeric proteins (N-terminal Rickettsia + C-terminal E. coli SecA) restored function .

Signal Peptidases

  • LepB (SPase I): Processes preproteins after Sec-dependent translocation. R. typhi LepB complements E. coli mutants .

  • LspA (SPase II): Processes lipoproteins. R. typhi LspA restores growth in E. coli temperature-sensitive mutants .

TolC-Dependent Secretion

  • RARP-1: An ankyrin repeat protein secreted via a hybrid Sec-TolC pathway in R. typhi. Requires Sec for inner membrane translocation and TolC for outer membrane export .

Gaps in Knowledge: SecD in Rickettsia typhi

  • Cloned or expressed recombinant R. typhi SecD.

  • Tested its interaction with other Sec components.

  • Evaluated its role in virulence or intracellular survival.

Comparative Analysis of Sec Pathway Components

ComponentR. typhi HomologFunctional Complementation in E. coliKey Findings
SecAYesPartial (chimeric proteins only)Species-specific C-terminal domain limits cross-compatibility .
LepB (SPase I)YesYesCleaves signal peptides post-translocation .
TolCYesPartialRequired for RARP-1 secretion; restores function in E. coli mutants .
SecDPresumedNot testedNo experimental data available.

Future Directions

  • Heterologous Expression: Cloning secD from R. typhi and testing its ability to complement E. coli SecD/SecF mutants.

  • Protein-Protein Interaction Studies: Mapping interactions between SecD, SecF, and SecY in Rickettsia.

  • Role in Pathogenesis: Investigating whether SecD contributes to effector protein secretion during infection.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have a specific format requirement, kindly indicate it in your order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which customers can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
secD; RT0575; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-518
Protein Length
full length protein
Species
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Target Names
secD
Target Protein Sequence
MQNLPKWKIVLSIICTVFAIICALPNFIQINWKFLPHDSVNLGLDLRGGANLLLDVDFDT YLNDSMENIADTLRKNFREHKIGYKNLLVRHNNIQLEVRSTEVLKSLKKIIHKIDPEIII EVNKNKIKLRYSESRLNDLLNKVVEQSIEIVRMRIDSTGTKEPILQRQGNKHILLQVPGV DNPSYLKNILGKTAKLTFHLVDENANIEEAIKGHIPLDSMLIKGDSEHHGEYYIVIKKKV LLSGTHLTKASASFDQNSQPMVAFSFNNLGSKIFTEITKNNTGKRLAIVLDNKLLSAPMI NGAIIGGDGIITGNFTIESANELALLLRVGSLPTPLKIIEERSIGPNLGADSIESGKKAG LIGFTAVCIFMILSYGVIGLFANIALILALLYILALLSLFQATLTLPGIAGIILTMGMAV DANVLIYERIKEELHKGVSNLYAIRTGFESAFATIIDSNLTTLIVAFALYIFGVGAIKGF AVALTIGIISSMFSAIIITKLLIDIWVKYFKPEKLGLL
Uniprot No.

Target Background

Function
This protein is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
Database Links

KEGG: rty:RT0575

STRING: 257363.RT0575

Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.