Recombinant Rickettsia typhi Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Table 1: Key Molecular Features of R. typhi SecF

FeatureDetails
Gene locusRT0022
Protein length308 aa
Storage conditionsTris-based buffer with 50% glycerol; store at -20°C or -80°C
Homolog in R. rickettsiiA8GQT5 (87% identity)

Functional Role in the Sec Translocase System

Mechanistic Context
SecF operates within the Sec pathway, which includes:

  • SecYEG: Core transmembrane channel.

  • SecA: ATPase driving preprotein translocation.

  • SecDF: Regulates secretion efficiency and interacts with SecYEG .

Key Findings

  • Operon Structure: In R. rickettsii, secF is cotranscribed with nuoF (NADH dehydrogenase) and lepB (signal peptidase I) as part of a polycistronic mRNA, suggesting coordinated regulation of protein secretion and energy metabolism .

  • Functional Complementation: While Rickettsia SecA requires chimeric constructs (e.g., R. rickettsii N-terminal + E. coli C-terminal) to function in E. coli , SecF homologs retain structural conservation across species, enabling their use in heterologous systems .

Research Applications and Experimental Models

Recombinant Protein Utility

  • ELISA and Binding Studies: Recombinant SecF is used to study antibody responses in Rickettsia infections .

  • Mechanistic Studies: E. coli surrogate systems reveal TolC-dependent secretion of Sec-processed substrates like RARP-1, implicating SecF in outer membrane translocation .

Table 2: Experimental Models for SecF Functional Analysis

Model SystemKey FindingsSource
E. coli complementationR. typhi SecF integrates into E. coli Sec translocon for preprotein export .
PhoA gene fusion assayValidated SecF’s role in periplasmic targeting of Sec substrates .

Challenges and Unresolved Questions

  • Species Specificity: The C-terminal domain of Rickettsia SecA fails to complement E. coli SecA mutants, suggesting divergent interactions with SecF/SecYEG .

  • TolC Interdependence: SecF-dependent substrates like RARP-1 require TolC for outer membrane translocation, but the energy source for this process remains unclear .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please include this in your order notes. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during the production process. If you have a specific tag type requirement, please inform us and we will prioritize its inclusion in the production process.
Synonyms
secF; RT0022; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Target Names
secF
Target Protein Sequence
MQIYPLRFVPNKINFDFMNFKKVSYSFSIILSLISLIWIGIYKFNFGIDFVGGIVIEVRL DRAPDLPKMRAVLSALGIGEVVLQNFESEHDLSIRFGSSSEENLMKNIDIIKTSLRNNFP YNFEYRKVDFVGPQVGRHLIEAGAMAMLFSFLAIMVYIGVRFEWYFGFGILIALVHDVIL ALGFMSITKLDFNLSTIAAVLTIIGYSVNDSVVIYDRIRENLRKYHKKNITEIINLSINE TLSRTILTVITTLLANLALILFGGKAIHSFSVLVFFGIIAGTYSSIFISAPILTIFANRK FNKKVIER
Uniprot No.

Target Background

Function
SecF is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
Database Links

KEGG: rty:RT0022

STRING: 257363.RT0022

Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Protein translocase subunit SecF in Rickettsia typhi and what role does it play in bacterial physiology?

SecF in R. typhi is a membrane protein component of the Sec translocon system, which mediates protein translocation across the bacterial cytoplasmic membrane. It works in conjunction with other Sec components to form a channel through which proteins are transported from the cytoplasm to the periplasm or extracellular environment. Genomic analyses indicate that rickettsiae contain all functional components of the Sec system . SecF specifically assists in the later stages of protein translocation, using proton motive force to facilitate the release of translocated proteins and enhance translocation efficiency.

The R. typhi SecF consists of 308 amino acids and is predicted to contain multiple transmembrane domains, consistent with its function as a membrane-embedded translocon component . As an obligate intracellular pathogen, R. typhi relies on efficient protein secretion systems to facilitate host-pathogen interactions, making SecF an important contributor to pathogen survival and virulence.

How conserved is the SecF protein across Rickettsia species and related bacteria?

Similar to the surface cell antigen (Sca) proteins that show varying levels of conservation and evidence of positive selection across Rickettsia groups , SecF may exhibit sequence divergence that reflects adaptation to different host environments. Researchers investigating SecF conservation should perform comparative sequence analysis across multiple Rickettsia genomes to identify conserved functional domains and potentially variable regions that might indicate host-specific adaptations.

What is known about the expression pattern of SecF during the R. typhi infection cycle?

Given that protein secretion is essential throughout the bacterial life cycle but may be particularly important during specific stages of infection (such as initial invasion, phagosomal escape, and cell-to-cell spread), SecF expression might be similarly regulated in response to changing environmental conditions and bacterial growth phases during infection.

What are the recommended methods for purifying recombinant R. typhi SecF protein for structural and functional studies?

Purification of recombinant R. typhi SecF presents challenges typical of membrane proteins. Based on available information , successful expression and purification strategies include:

  • Expression system selection: E. coli-based systems with specialized strains designed for membrane protein expression are typically used.

  • Construct optimization: The full-length protein (308 amino acids) can be expressed, with appropriate fusion tags determined during the production process .

  • Purification protocol:

    • Cell lysis under conditions that preserve membrane protein structure

    • Membrane solubilization using appropriate detergents

    • Affinity chromatography utilizing fusion tags

    • Size exclusion chromatography for final purification

  • Storage conditions: A Tris-based buffer containing 50% glycerol is recommended, with storage at -20°C for short-term use or -80°C for extended storage . Repeated freeze-thaw cycles should be avoided.

How can researchers detect SecF expression and localization during R. typhi infection?

Based on methodologies described for other R. typhi proteins, the following approaches can be adapted for SecF detection:

  • Transcript analysis: RT-PCR or qPCR can be used to detect and quantify secF transcripts in total RNA extracted from infected cells at different time points, similar to the approach used for sca genes .

  • Protein detection by Western blotting: Cell fractionation protocols separating bacterial and host components can be employed, followed by immunoblotting with SecF-specific antibodies. Controls should include bacterial cytoplasmic proteins (e.g., EF-Ts) and host cytoplasmic proteins (e.g., GAPDH) to validate fractionation quality .

  • Immunofluorescence microscopy: Development of specific antibodies against SecF would allow visualization of protein localization during infection using immunofluorescence assays, as demonstrated for Pat1 and Pat2 proteins . This approach can reveal whether SecF remains exclusively associated with the bacterial membrane or shows other localization patterns.

  • Surface protein analysis: Although SecF is predicted to be a membrane protein rather than surface-exposed, techniques like surface biotinylation followed by LC-MS/MS could help determine if any regions of SecF are accessible on the bacterial surface .

What experimental approaches can determine the role of SecF in R. typhi protein secretion and pathogenesis?

Investigating SecF function in R. typhi requires creative experimental designs due to the challenges of genetic manipulation in obligate intracellular bacteria. Recommended approaches include:

  • Antibody inhibition studies: Similar to approaches used for Pat1 and Pat2 , antibodies against SecF could be used to pretreat rickettsiae before infection assays. Subsequent measurement of invasion efficiency and plaque formation could reveal SecF's role in infection.

  • Protein-protein interaction analysis: Co-immunoprecipitation or bacterial two-hybrid assays could identify proteins that interact with SecF, including potential secretion substrates and other components of the Sec machinery.

  • Comparative proteomics: Analysis of proteins secreted under different conditions might reveal patterns consistent with Sec-dependent secretion. Bioinformatic prediction of signal sequences can help identify potential Sec substrates.

  • Heterologous expression systems: Testing whether R. typhi SecF can complement SecF-deficient strains of more genetically tractable bacteria could provide functional insights.

  • Temporal correlation analysis: Comparing the expression timing of SecF with known virulence factors during infection could suggest functional relationships.

Table 1: Experimental approaches for studying R. typhi SecF function

ApproachMethodologyKey ControlsExpected Outcomes
Antibody inhibitionPretreatment of rickettsiae with anti-SecF antibodies before infectionPre-immune IgG treatmentReduction in invasion efficiency or plaque formation if SecF is important for early infection events
Protein-protein interactionsCo-immunoprecipitation with anti-SecF antibodiesIgG-only precipitationIdentification of SecF interaction partners, including potential substrates
Comparative proteomicsLC-MS/MS analysis of secreted proteins under different conditionsCytoplasmic protein markersIdentification of potential Sec-dependent secreted proteins
Heterologous expressionExpression of R. typhi SecF in SecF-deficient E. coliEmpty vector controlFunctional complementation would suggest conserved function
Temporal expression analysisqRT-PCR of secF and potential substrate genesHousekeeping gene expressionCorrelation between SecF and substrate expression would suggest coordinated regulation

How does the Sec translocon in R. typhi interact with other secretion systems during infection?

R. typhi employs multiple secretion systems for protein translocation across membranes. The relationship between these systems appears complex and interconnected:

  • The Sec translocon (including SecF) provides the primary pathway for protein export across the cytoplasmic membrane .

  • Type IV Secretion System (T4SS): R. typhi possesses a P-like T4SS termed the Rickettsiales vir homolog (rvh) T4SS that may transport substrates with C-terminal secretion signals .

  • Type I Secretion System (T1SS): Rickettsia species encode TolC (the outer membrane component of T1SS) and associated proteins that likely assemble into functional T1SSs .

  • Non-canonical pathways: Evidence suggests some proteins are exported via pathways that utilize components from multiple systems. For example, an ankyrin domain-containing protein is reportedly exported "via a non-canonical secretion pathway that utilizes both the Sec translocon and TolC" .

The Sec system likely provides the initial translocation step for many proteins that are subsequently processed by other secretion systems for final export. Understanding these relationships is crucial for deciphering how various virulence factors reach their destinations during infection.

What types of proteins are predicted to be SecF-dependent substrates in R. typhi?

While the search results don't provide a comprehensive list of confirmed SecF-dependent substrates, we can infer characteristics of likely substrates:

  • Surface and secreted proteins involved in host-pathogen interactions: "Surface proteins of the obligate intracellular bacterium Rickettsia typhi... comprise an important interface for host-pathogen interactions including adherence, invasion and survival in the host cytoplasm" .

  • Proteins with Sec-dependent signal sequences: Typical Sec substrates contain N-terminal signal sequences that target them to the translocon.

  • Virulence factors: Proteins like phospholipase A2 enzymes (Pat1 and Pat2) that are secreted into host cytoplasm during infection may rely on the Sec pathway for initial export steps, even if they lack conventional signal sequences.

  • Surface cell antigens (Sca proteins): These autotransporter family proteins are detected on the R. typhi surface and likely require the Sec system for initial translocation before their autotransporter domains facilitate final localization.

Bioinformatic prediction tools can be used to identify proteins with potential Sec-dependent signal sequences in the R. typhi genome, providing candidates for experimental validation.

What is the current understanding of signal sequence requirements for Sec-dependent secretion in R. typhi?

  • Some R. typhi secreted proteins lack conventional signal sequences: For example, "Pat1 and Pat2 do not contain predicted Sec-dependent signal sequences" , yet are secreted into host cells during infection.

  • Non-canonical secretion pathways may exist: The search results mention proteins that are "predicted to be noncytoplasmic with no Sec-dependent signal peptide sequence" , suggesting alternative targeting mechanisms.

  • C-terminal signals: Some secreted proteins may contain C-terminal signals rather than N-terminal ones: "Substrates translocated by both I- and P-like T4SSs often contain C-terminal signals" .

  • Possible processing during secretion: Evidence suggests potential processing of secreted proteins, as "the slightly slower mobility of rickettsiae-associated Pat1 and Pat2 proteins versus Pat1 and Pat2 proteins that are translocated into the host cytoplasm might be due to the cleavage of a short signal sequence during translocation" .

These observations indicate that R. typhi may utilize both conventional and specialized mechanisms for protein targeting to secretion pathways, reflecting its adaptation to an intracellular lifestyle.

What challenges exist in studying the function of membrane proteins like SecF in obligate intracellular bacteria?

Investigating SecF function in R. typhi presents several significant challenges:

  • Genetic manipulation limitations: "The obligate intracellular lifestyle of rickettsiae makes genetic manipulation difficult and impedes progress towards identification of virulence factors" .

  • Cultivation requirements: R. typhi requires host cells for propagation, complicating the isolation of bacterial components and the design of experimental interventions.

  • Membrane protein instability: As a multi-pass membrane protein, SecF presents general challenges associated with membrane protein expression, purification, and structural characterization.

  • Secretion pathway redundancy: The potential overlap between different secretion systems may complicate the attribution of specific phenotypes to SecF function.

  • Temporal regulation: Gene expression patterns vary during infection , necessitating time-course studies to capture the full spectrum of SecF activity.

Overcoming these challenges requires creative experimental approaches, combining biochemical studies of recombinant proteins, heterologous expression systems, and careful in vivo studies with appropriate controls.

How might post-translational modifications affect the function of R. typhi SecF?

While the search results don't specifically address post-translational modifications (PTMs) of SecF in R. typhi, several observations suggest their potential importance:

  • Protein processing during secretion: The search results note differences in mobility between bacterial-associated and secreted forms of proteins, suggesting potential processing events .

  • Adaptation to intracellular environment: As an intracellular pathogen, R. typhi must function within the unique biochemical environment of host cells, potentially requiring PTMs for optimal protein function.

  • Regulation of secretion activity: PTMs could provide a mechanism for rapidly modulating SecF activity in response to changing conditions during the infection cycle.

Potential approaches to investigate SecF PTMs include:

  • Mass spectrometry analysis of purified SecF to identify modifications

  • Site-directed mutagenesis of potential modification sites to assess functional impacts

  • Comparative analysis of SecF under different growth conditions to detect condition-dependent modifications

What insights into SecF function can be gained from studying related rickettsial pathogens?

Comparative studies across Rickettsia species can provide valuable insights into SecF function:

  • Conservation patterns: Highly conserved regions likely represent functionally critical domains, while variable regions might reflect adaptation to different hosts or niches.

  • Correlation with pathogenicity: Comparing SecF characteristics across Rickettsia species with different pathogenicity profiles could reveal features associated with virulence.

  • Host-specific adaptations: Variations in SecF across species adapted to different arthropod vectors and mammalian hosts might indicate host-specific functional requirements.

  • Evolutionary pressure: Analysis of synonymous versus non-synonymous mutations could identify regions under positive selection, potentially indicating host-adaptation sites.

Experimental approaches that leverage these comparative insights include:

  • Cross-complementation studies testing whether SecF from one species can functionally replace that of another

  • Chimeric protein studies to identify which regions confer species-specific functions

  • Correlation of SecF sequence features with host range or pathogenicity characteristics

What are the most promising therapeutic targets within the R. typhi Sec translocon system?

The essential nature of protein secretion for bacterial pathogen survival makes the Sec system a potential therapeutic target. Promising approaches include:

  • SecF inhibition: As a membrane-associated component that uses proton motive force, SecF could be targeted with small molecules that disrupt its energy coupling or interaction with other Sec components.

  • Substrate binding interference: Compounds that mimic Sec signal sequences could competitively inhibit substrate binding to the translocon.

  • SecA inhibition: While not directly discussed in the search results, the SecA ATPase (which provides energy for translocation) is typically an essential component of the Sec system and could be targeted with ATP-competitive inhibitors.

  • Antibody-based approaches: The search results demonstrate that antibody pretreatment of rickettsiae against secreted proteins "indicated a significant decrease in R. typhi infection" . Similar approaches targeting accessible components of the Sec system could potentially interfere with rickettsial infection.

  • Cross-system inhibition: Given the evidence for interaction between different secretion systems , compounds targeting shared components or interfaces between systems might be particularly effective.

How might high-resolution structural studies of R. typhi SecF contribute to understanding its function?

Structural characterization of R. typhi SecF would provide significant insights:

  • Transmembrane topology confirmation: Experimental validation of predicted transmembrane domains would clarify SecF's membrane orientation.

  • Substrate interaction sites: Identifying regions involved in substrate protein binding could reveal specificity determinants.

  • Energy coupling mechanism: Understanding how SecF couples proton translocation to protein movement would illuminate its functional mechanism.

  • Conformational changes: Capturing different conformational states could reveal the dynamic aspects of SecF function during protein translocation.

  • Species-specific features: Comparing R. typhi SecF structure with those from other bacteria could highlight unique adaptations of the rickettsial protein.

Technical approaches might include:

  • Cryo-electron microscopy of purified SecF or the complete Sec translocon

  • X-ray crystallography of stable domains or SecF variants engineered for crystallizability

  • Molecular dynamics simulations based on homology models and experimental constraints

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

What is the potential relationship between SecF function and antibiotic resistance in Rickettsia species?

While the search results don't directly address antibiotic resistance in relation to SecF, several potential connections can be proposed:

  • Antibiotic export: Some antibiotics target intracellular processes, requiring penetration through bacterial membranes. The Sec system or associated proteins might influence this penetration or actively export certain antibiotics.

  • Stress response: Antibiotic exposure typically induces bacterial stress responses that may involve altered protein secretion patterns, potentially affecting SecF expression or activity.

  • Membrane composition: SecF function could influence membrane protein composition, indirectly affecting membrane permeability to antibiotics.

  • Secreted resistance factors: Proteins involved in antibiotic modification or resistance might require SecF-dependent secretion to reach their functional locations.

  • Biofilm formation: If R. typhi forms biofilm-like structures in certain contexts, SecF-dependent secretion might contribute to producing extracellular matrix components that provide antibiotic tolerance.

Research approaches to investigate these relationships could include:

  • Comparative transcriptomics/proteomics of R. typhi under antibiotic stress

  • Analysis of antibiotic susceptibility patterns in relation to SecF expression levels

  • Identification of SecF-dependent proteins involved in stress responses

What are the critical quality control parameters for recombinant R. typhi SecF production?

Ensuring high-quality recombinant SecF protein requires attention to several parameters:

  • Protein solubility and stability: As a membrane protein, SecF requires appropriate detergents or membrane mimetics to maintain native conformation. The storage recommendation in "Tris-based buffer, 50% glycerol" suggests conditions that promote stability.

  • Purity assessment: SDS-PAGE, size exclusion chromatography, and mass spectrometry should confirm protein integrity and purity.

  • Functional validation: While specific assays for SecF function are not detailed in the search results, potential approaches include proteoliposome reconstitution followed by protein translocation assays.

  • Secondary structure integrity: Circular dichroism spectroscopy can confirm the expected high alpha-helical content typical of membrane proteins.

  • Aggregation monitoring: Dynamic light scattering or analytical ultracentrifugation can detect protein aggregation that might compromise functional studies.

  • Endotoxin removal: For studies involving cell culture or immunological assays, endotoxin testing and removal are essential to prevent artifacts.

What are the most appropriate model systems for studying R. typhi SecF function in vivo?

Given the challenges of working with obligate intracellular bacteria, several model systems offer complementary advantages:

  • Cell culture infection models: The search results describe using L929 fibroblasts and Vero76 cells for R. typhi infection studies. These established cell lines provide controlled environments for studying bacterial protein expression and localization during infection.

  • Heterologous expression systems: E. coli strains with SecF deletions or conditional expression could be complemented with R. typhi SecF to assess functional conservation and specificity.

  • In vitro reconstitution: Purified SecF reconstituted into liposomes or nanodiscs with other Sec components could enable biochemical characterization of translocation activity.

  • Arthropod vector models: For advanced studies, arthropod vectors (fleas) that naturally transmit R. typhi could provide insights into SecF function during the vector stage of the life cycle.

  • Animal infection models: Mouse models of R. typhi infection could be used to study the role of SecF in pathogenesis, though genetic manipulation would remain challenging.

Each model system has limitations that should be considered when interpreting results, particularly regarding the artificial nature of in vitro systems versus the complexity of in vivo environments.

What are the most critical unanswered questions about R. typhi SecF that warrant further investigation?

Several key questions remain unanswered regarding R. typhi SecF:

  • Secretion mechanism: How do proteins lacking conventional signal sequences, like Pat1 and Pat2 , engage with the Sec machinery? Does SecF play a specialized role in recognizing non-canonical substrates?

  • Interaction network: What is the complete set of proteins that interact with SecF during the R. typhi infection cycle? How do these interactions change under different conditions?

  • Host-specific adaptation: How has SecF evolved in R. typhi compared to related species, and do these differences reflect adaptation to specific host environments?

  • Regulation mechanisms: How is SecF expression and activity regulated during different stages of infection? Are there post-translational modifications that modulate its function?

  • Therapeutic potential: Can SecF function be selectively inhibited to control R. typhi infection without affecting host protein secretion?

Addressing these questions will require innovative approaches that overcome the experimental challenges posed by this obligate intracellular pathogen while leveraging comparative genomics, structural biology, and host-pathogen interaction studies.

How might emerging technologies advance our understanding of SecF function in intracellular pathogens?

Emerging technologies offer promising avenues for overcoming current limitations in studying R. typhi SecF:

  • CRISPR interference/activation: While complete gene deletion remains challenging in Rickettsia, CRISPRi/a approaches might enable conditional modulation of SecF expression.

  • Single-cell techniques: Single-cell RNA-seq and spatial transcriptomics could reveal cell-to-cell variability in SecF expression during infection and identify microenvironmental factors influencing its regulation.

  • Advanced imaging: Super-resolution microscopy and correlative light-electron microscopy could provide unprecedented insights into SecF localization and dynamics during infection.

  • Protein engineering: Split fluorescent protein tags and proximity labeling techniques could map SecF interactions in living bacteria during infection.

  • Structural biology advances: Cryo-electron tomography and in-cell NMR methods might eventually enable structural studies of SecF in its native environment.

  • Synthetic biology: Minimal synthetic systems reconstituting essential R. typhi secretion components could allow functional dissection of SecF's contribution to protein translocation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.