Recombinant Rickettsia typhi Putative sensor histidine kinase ntrY-like (RT0603)

Shipped with Ice Packs
In Stock

Description

3.2. Experimental Use Cases

  • Pathogenesis Studies: Recombinant RT0603 enables in vitro investigations into TG-specific virulence mechanisms .

  • Antimicrobial Target Exploration: Histidine kinases are emerging targets for novel antibiotics due to their absence in humans .

  • Immunological Assays: Tools like GFPuv-tagged R. typhi (developed using similar recombinant techniques) facilitate immune response analysis, including CD8+ T cell activation .

Technical Considerations for Use

ParameterRecommendation
ReconstitutionUse deionized sterile water (0.1–1.0 mg/mL) with 50% glycerol for storage .
StabilityAvoid repeated freeze-thaw cycles; store aliquots at -80°C .
Activity AssaysPair with compatible response regulators (e.g., NtrX-like proteins) for phosphotransfer studies .

Comparative Analysis with Orthologs

SpeciesGene IDProtein IdentityHost Expression Systems
R. typhiRT0603100% (Reference)E. coli, mammalian cells
R. conoriiRC0948~75%Cell-free, E. coli
R. belliiRBE_0470~68%Yeast, baculovirus

Future Directions

  • Structural Resolution: X-ray crystallography or cryo-EM to elucidate RT0603’s activation mechanism.

  • Knockout Models: CRISPR-based gene editing to assess RT0603’s contribution to R. typhi virulence .

  • Drug Screening: High-throughput assays targeting RT0603’s kinase domain for inhibitor discovery .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize development of the specified tag.
Synonyms
RT0603; Putative sensor histidine kinase NtrY-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-599
Protein Length
full length protein
Species
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Target Names
RT0603
Target Protein Sequence
MLSYLKQNLCFYLSSKILILALAISAIVSACTTFYVISLEAKNFSTIIGFLLIDLAIFLI LGILLTQKFFSKNNDNDSSRLQNRIVIAFSLVAAIPTIIVSVFSVYFFNLSVKAWFDKKI STVLDQSVIVAETYIAEHKVQLKETALAVAEDLSDMYYDLIHNPALFTKTLNTEADMRSL DEAIVLNKSTNTIVANSYLSFSLSFATIPAHLIKKADLGEPVEVKSDPTKIRMLIKLKEY NDVYLLVGRLVDNKIIDHIDATNGAAAEYNSLKNEIDNIQIKFSIMFIFIALLLLFVAIN FGVLFTAQIVKPIKKLVTATDKVKDGDLTVQVPENEVDKDEIGTLYVAFNRMIKQLSRQQ RDLVIAQRAMAWSDVAKKVAHEIKNPLTPILLASERLLKKFSAEIKDKSEFESYLKMIIR HTNDIKNIVSEFVLFARLPAPKFTKSELVYLVKHIIEARKLLNDNIVYTCDSNVDQFDFM CDATQINQVMINVLKNAEESIEGQEFGRIDVILDIKDDFINVIVMDNGKGFPPELIGKAT ESYVTTSSKGMGVGLAIVKRIVEEHCGVLDIANREDKGAIIDIKFDLKELHLKVRRSCG
Uniprot No.

Target Background

Function
This protein is a member of the two-component regulatory system RT0603/RT0550.
Database Links

KEGG: rty:RT0603

STRING: 257363.RT0603

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is RT0603 and what is its functional role in bacterial signaling?

RT0603 (UniProt ID: Q68WC5) is a putative sensor histidine kinase ntrY-like protein found in Rickettsia typhi strain ATCC VR-144 / Wilmington. It functions as a membrane-embedded sensor in a two-component regulatory system (TCS) paired with RT0550 . As part of this system, RT0603 serves as a signal transduction protein that couples environmental sensing to cytosolic effector responses.

The protein exhibits the following characteristics:

  • Length: 599 amino acids

  • Location: Cell membrane (integral component)

  • Molecular functions: ATP binding and phosphorelay sensor kinase activity

  • Enzymatic activity: EC 2.7.13.3 (histidine kinase)

RT0603 is predicted to participate in nitrogen regulation pathways, as suggested by its similarity to NtrY-like proteins , though its specific cellular role requires further investigation in Rickettsia typhus biology.

What are the structural characteristics and domain organization of RT0603?

RT0603 displays a modular domain architecture typical of bacterial sensor histidine kinases, with distinct functional regions:

Domain TypePositionFunction
Transmembrane domains (TM)N-terminal regionMembrane anchoring and signal detection
PF17203Following TM domainsExtracellular sensing domain
HAMP domain (PF00672)Central regionSignal transmission module
Histidine kinase A (PF00512)C-terminal regionDimerization and phosphorylation site
HATPase_c (PF02518)C-terminal regionCatalytic ATP-binding domain

The protein contains multiple transmembrane helices that anchor it in the cell membrane, with extracellular regions likely involved in signal recognition and cytoplasmic domains mediating phosphotransfer reactions . The HAMP domain is particularly important as it connects the transmembrane sensing regions to the cytoplasmic signaling modules, often serving as a conformational signal converter .

How does the two-component signaling mechanism function in RT0603?

The RT0603 protein operates within a canonical two-component system (TCS) signal transduction pathway that includes:

  • Signal Detection: Environmental stimuli are detected by the extracellular or membrane-embedded sensor domains of RT0603 .

  • Conformational Change: Signal binding induces conformational changes that propagate through the transmembrane and HAMP domains .

  • Autokinase Activity: These conformational changes alter the cytoplasmic kinase domain's activity, promoting ATP binding and autophosphorylation of a conserved histidine residue .

  • Phosphotransfer: The phosphoryl group is transferred from the histidine kinase to an aspartate residue on its cognate response regulator (likely RT0550) .

  • Transcriptional Regulation: The phosphorylated response regulator modulates gene expression of target regulons .

Recent research suggests that rather than a simple linear conformational change, signal transmission likely occurs through interdomain allostery involving a series of equilibrium shifts between active and inactive states of each domain . This is described as a "semi-empirical three-domain model" where the sensor, HAMP, and catalytic domains can adopt kinase-promoting or inhibiting conformations that communicate allosterically .

What expression systems are optimal for producing recombinant RT0603?

Based on current research protocols and available recombinant products, the following expression systems have proven effective for RT0603:

Expression SystemAdvantagesConsiderations
E. coliHigh yields, established protocols, cost-effectiveMembrane protein expression challenges, potential folding issues
Cell-free systemsAvoids toxicity issues, suitable for membrane proteinsLower yields, higher cost

For successful expression of RT0603:

  • Vector selection: Vectors containing N-terminal His-tags have been successfully used . The tag placement should consider the transmembrane topology to ensure accessibility during purification.

  • E. coli strain selection: BL21(DE3) or Rosetta strains are commonly used for membrane proteins with rare codons .

  • Induction conditions: Lower temperatures (16-18°C) after induction and reduced IPTG concentrations often improve folding of membrane-associated histidine kinases .

  • Membrane fraction isolation: Proper separation of membrane fractions is critical for evaluating expression levels, as RT0603 contains multiple transmembrane domains .

Currently available recombinant RT0603 products are expressed in E. coli with N-terminal His-tags, demonstrating the feasibility of this approach .

What purification strategies are most effective for recombinant RT0603?

Given the membrane-associated nature of RT0603, specialized purification approaches are necessary:

  • Membrane protein extraction:

    • Detergent screening is critical; mild non-ionic detergents (DDM, LMNG) or zwitterionic detergents (CHAPS, FC-12) are commonly used

    • Gentle solubilization at 4°C with proper detergent:protein ratios optimizes extraction while maintaining structure

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resins for His-tagged RT0603

    • Gradual imidazole gradients (20-300mM) improve purity

  • Buffer optimization:

    • Inclusion of glycerol (typically 50%) enhances stability during storage

    • Tris-based buffers at pH 8.0 are commonly used for RT0603

  • Storage considerations:

    • Store at -20°C/-80°C for extended periods

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be maintained at 4°C for up to one week

Current protocols recommend reconstitution of lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for long-term storage .

What methods are available for assessing RT0603 kinase activity?

Several complementary approaches can be employed to evaluate the kinase activity of RT0603:

  • Autophosphorylation assays:

    • Incubation with [γ-³²P]ATP followed by SDS-PAGE and autoradiography

    • Non-radioactive alternatives using phospho-specific antibodies or Phos-tag acrylamide gels

  • Phosphotransfer assays:

    • Co-incubation of RT0603 with its putative response regulator (RT0550) and [γ-³²P]ATP

    • Monitoring phosphoryl group transfer from histidine kinase to response regulator

  • ATPase activity measurements:

    • Coupled enzyme assays (pyruvate kinase/lactate dehydrogenase) to monitor ATP hydrolysis

    • Malachite green assays to detect released inorganic phosphate

  • Fluorescence-based approaches:

    • FRET sensors incorporating portions of RT0603 and its response regulator

    • Environment-sensitive fluorophores positioned near the catalytic site

These assays should be conducted with appropriate controls to account for the influence of buffer conditions, detergents, and potential ligands on kinase activity . For transmembrane histidine kinases like RT0603, reconstitution into liposomes or nanodiscs may provide a more native-like membrane environment for functional studies .

How can researchers investigate the signal sensing mechanisms of RT0603?

Understanding how RT0603 detects environmental signals requires multifaceted approaches:

  • Ligand binding studies:

    • Given the NtrY-like classification, nitrogen-containing compounds would be logical starting points

    • Isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) with the isolated sensor domain

    • Surface plasmon resonance (SPR) with immobilized sensor domain

  • Structural analysis of the sensor domain:

    • X-ray crystallography of isolated periplasmic domains

    • Cryo-EM for full-length or substantial portions of the protein

    • NMR studies of isolated domains

  • Mutagenesis approaches:

    • Alanine-scanning of potential ligand-binding residues in the periplasmic domain

    • Conservative mutations in transmembrane helices to probe signal transmission

    • Chimeric constructs with sensor domains from related kinases

  • Computational methods:

    • Molecular dynamics simulations of transmembrane helix interactions

    • Ligand docking studies with the sensor domain

    • Sequence/structure comparisons with characterized NtrY-like kinases

The allosteric coupling model described for PhoQ provides a framework for understanding how conformational changes might propagate through RT0603's domains. This model suggests that mutations can alter signaling by locally modulating domain equilibrium constants and interdomain couplings .

What techniques can be used to study RT0603-membrane interactions?

Understanding how RT0603 interacts with the bacterial membrane is crucial for elucidating its function:

  • Membrane topology mapping:

    • PhoA/LacZ fusion analysis to determine cytoplasmic vs. periplasmic domains

    • Cysteine accessibility methods using membrane-permeable and -impermeable reagents

    • Protease protection assays to identify exposed regions

  • Lipid interaction analysis:

    • Liposome binding assays with fluorescently labeled RT0603

    • Monolayer penetration experiments to measure membrane insertion

    • Lipid strip assays to identify specific lipid binding preferences

  • Transmembrane domain characterization:

    • Replica exchange molecular dynamics (REMD) to model transmembrane helix interactions

    • Disulfide cross-linking experiments to validate transmembrane helix proximity

    • FRET-based approaches to measure conformational changes within the membrane

  • Native membrane environment reconstitution:

    • Nanodiscs containing defined lipid compositions

    • Proteoliposomes with controlled lipid content

    • Polymer-based membrane mimetics (SMALPs, amphipols)

Recent studies on related histidine kinases suggest that transmembrane signal transduction can occur through subtle alterations in the positions of transmembrane helices within membrane-embedded complexes . Similar mechanisms might operate in RT0603.

How does RT0603 compare to other bacterial sensor histidine kinases?

RT0603 shares structural and functional features with other bacterial sensor histidine kinases, but also displays distinct characteristics:

FeatureRT0603Typical HKsNotes
Domain OrganizationTM-TM-TM-PF17203-TM-HAMP-HisKA-HATPase_cTM-Sensor-HAMP-HisKA-HATPase_cRT0603 has more TM domains than typical HKs
Sensory ModuleMultiple TM domains + PF17203PAS, GAF, or periplasmic domainsDifferent sensing strategy
ClassificationNtrY-likeDiverse familyRelated to nitrogen sensing systems
System PartnerRT0550Cognate response regulatorForms two-component regulatory system

The presence of multiple transmembrane domains suggests RT0603 might detect membrane-associated or transmembrane signals, similar to PhoQ . The NtrY-like classification suggests potential roles in nitrogen regulation, though this requires experimental validation in Rickettsia typhi .

What are the challenges in functional characterization of RT0603 in Rickettsia typhi?

Working with RT0603 in its native Rickettsia typhi context presents significant challenges:

  • Genetic manipulation limitations:

    • Rickettsia spp. have historically been genetically intractable

    • Recent advances with SFG rickettsiae have improved genetic tools, but TG species like R. typhi remain challenging

    • Limited promoter characterization and selective markers for R. typhi

  • Obligate intracellular lifestyle:

    • Requirement for host cells complicates experimental design

    • Difficulty separating bacterial and host cell responses

    • Limited bacterial biomass for biochemical studies

  • Biosafety considerations:

    • R. typhi is a BSL-2/3 pathogen requiring specialized containment

    • Risk of laboratory-acquired infections limits experimental approaches

    • Use of model species (e.g., R. parkeri) as alternatives requires validation

  • Technical approaches to overcome these challenges:

    • Heterologous expression systems for RT0603 functional characterization

    • Transcriptomics/proteomics with refined bacterial enrichment protocols

    • Use of surrogate non-pathogenic bacteria expressing RT0603

    • Complementation studies in other bacteria with defective NtrY-like systems

Despite these challenges, recent advances in Rickettsia research, including GFPuv-expressing recombinant R. typhi strains, provide promising new tools for future studies .

How can researchers investigate RT0603's potential role in Rickettsia pathogenesis?

Investigating RT0603's contribution to pathogenesis requires multiple experimental approaches:

  • Comparative genomics and expression analysis:

    • Sequence and expression comparison between pathogenic and non-pathogenic Rickettsia species

    • Transcriptomic analysis of RT0603 expression during different infection stages

    • Examination of RT0603/RT0550 expression in different host cell types

  • Functional inhibition strategies:

    • Small molecule inhibitors targeting histidine kinase activity

    • Antisense RNA or CRISPR interference approaches if genetic systems available

    • Host-directed therapies targeting pathways potentially regulated by RT0603

  • Host-pathogen interaction studies:

    • Identification of host pathways affected by RT0603 activity

    • Phosphoproteomics to detect changes dependent on RT0603 function

    • RT0603-specific antibodies to block potential extracellular interactions

  • Animal model approaches:

    • If mutants become available, virulence assessment in animal models

    • Passive immunization with antibodies against the sensor domain

    • Treatment with histidine kinase inhibitors during infection

The role of two-component systems in bacterial pathogenesis is well-established, with many serving as master regulators of virulence programming . If RT0603 functions similarly to other bacterial sensor histidine kinases, it could be involved in sensing host-associated signals and modulating bacterial gene expression in response to the intracellular environment .

What structural biology approaches are suitable for RT0603 characterization?

Determining the structure of RT0603 requires specialized approaches due to its membrane-associated nature:

  • X-ray crystallography challenges and solutions:

    • Difficulty crystallizing full-length membrane proteins

    • Strategies: lipidic cubic phase crystallization, antibody fragment co-crystallization

    • Domain-by-domain approach focusing on soluble domains (HAMP, kinase) first

  • Cryo-EM approaches:

    • Single particle analysis of detergent-solubilized or nanodisc-reconstituted RT0603

    • Typical resolution limitations for ~65 kDa proteins can be addressed by:

      • Fab fragment binding to increase molecular weight

      • Phase plate technology for improved contrast

      • Signal subtraction approaches for flexible regions

  • NMR spectroscopy applications:

    • Solution NMR for individual soluble domains

    • Solid-state NMR for membrane-embedded portions

    • Specific isotope labeling strategies (15N, 13C, 2H) for larger domains

  • Hybrid structural approaches:

    • Integrating low-resolution electron microscopy with high-resolution structures of individual domains

    • Molecular dynamics simulations to model domain interactions

    • Cross-linking mass spectrometry to provide distance constraints

  • Structural modeling considerations:

    • Template-based modeling using related histidine kinases with known structures

    • Ab initio modeling for unique domains

    • Validation through experimental approaches like SAXS or crosslinking

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.