Recombinant Rickettsia typhi Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rickettsia typhi Succinate Dehydrogenase Hydrophobic Membrane Anchor Subunit (sdhD)

The Recombinant Rickettsia typhi Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) is a crucial component of the succinate dehydrogenase (SDH) enzyme complex. This complex plays a pivotal role in the electron transport chain and is essential for cellular respiration. The sdhD subunit, specifically, serves as a hydrophobic membrane anchor, ensuring the proper integration of the SDH complex into the cell membrane.

Function and Importance of sdhD

The succinate dehydrogenase complex, including the sdhD subunit, is vital for converting succinate to fumarate during the citric acid cycle (also known as the Krebs cycle or tricarboxylic acid cycle). This process not only generates energy but also contributes to the electron transport chain, producing ATP. The sdhD subunit is crucial for anchoring the complex to the inner mitochondrial membrane in eukaryotic cells, although in prokaryotes like Rickettsia typhi, it anchors the complex to the cell membrane.

Research and Development of Recombinant sdhD

Recombinant Rickettsia typhi sdhD proteins are produced using various expression systems, including E. coli, yeast, baculovirus, and mammalian cells. These proteins are often used in research to study the structure and function of the SDH complex and its role in cellular metabolism. The recombinant full-length Rickettsia typhi sdhD protein, for example, is available with an N-terminal His tag, facilitating purification and detection .

Table 1: Expression Systems for Recombinant Rickettsia typhi sdhD

Expression SystemDescription
E. coliCommonly used for high-yield protein production, suitable for structural and functional studies.
YeastOffers a more eukaryotic-like environment, beneficial for studying protein modifications.
BaculovirusUtilizes insect cells, ideal for producing complex proteins with proper folding.
Mammalian CellsProvides a native eukaryotic environment, useful for studying protein interactions and modifications.

Applications and Research Findings

The recombinant sdhD subunit is valuable in biochemical and biophysical studies aimed at understanding the assembly and function of the SDH complex. It can also serve as a tool for investigating the pathogenic mechanisms of Rickettsia typhi, which causes murine typhus. Studies involving recombinant proteins like sdhD can help elucidate how these pathogens interact with host cells and evade immune responses.

Table 2: Key Features of Recombinant Rickettsia typhi sdhD

FeatureDescription
Protein LengthPartial or full-length (1-125 amino acids)
Purity>85% (SDS-PAGE)
SpeciesRickettsia typhi (strain ATCC VR-144 / Wilmington)
Uniprot No.Q68XP0
Subcellular LocationCell inner membrane; multi-pass membrane protein

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
sdhD; RT0116; Succinate dehydrogenase hydrophobic membrane anchor subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Target Names
Target Protein Sequence
MIYDFKAEIIKSKSSSSSKSGAHHWLLQRVTGVVLALCSFWLIYFMFTNKNNDINIIMWE FKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIVAFIVA IFYSE
Uniprot No.

Target Background

Function

Membrane-anchoring subunit of succinate dehydrogenase (SDH).

Database Links

KEGG: rty:RT0116

STRING: 257363.RT0116

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.