Recombinant Rickettsia typhi Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rickettsia typhi Ubiquinol-Cytochrome c Reductase Iron-Sulfur Subunit (petA)

The recombinant Rickettsia typhi ubiquinol-cytochrome c reductase iron-sulfur subunit (petA) is a bioengineered protein derived from the petA gene of R. typhi, a Gram-negative obligate intracellular bacterium causing murine typhus. This protein is a critical component of the bacterial electron transport chain (ETC), specifically functioning as part of the ubiquinol-cytochrome c reductase (cytochrome bc1 complex), which facilitates electron transfer and proton pumping across the inner membrane. Its recombinant form is produced for research, diagnostic, and therapeutic applications, leveraging its structural and functional conservation across Rickettsia species .

Expression and Production

Recombinant Production Systems
Recombinant petA is expressed in various hosts, including E. coli, yeast, baculovirus, and mammalian cells, with cell-free systems also employed . Key parameters include:

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, mammalian cells, or cell-free expression
Purity≥85% (SDS-PAGE validated)
Expression VectorspRAM18dRGA (for GFP-tagged variants in R. typhi)
YieldHigh plasmid copy numbers (e.g., 18.5 copies/bacterium in R. typhi)

Purification Methods
Post-expression, the protein is purified using standard chromatography techniques, with SDS-PAGE confirming purity .

Functional Studies and Interactions

Role in Electron Transport
PetA facilitates electron transfer from ubiquinol to cytochrome c, contributing to ATP synthesis. In Rickettsia, this process is critical for survival in host cells, where the bacteria hijack host resources .

Protein Interactions
PetA interacts with:

  • Succinate dehydrogenase: Part of the tricarboxylic acid (TCA) cycle, suggesting a role in linking ETC and metabolic pathways .

  • NADH dehydrogenase I: A subunit of the NADH-ubiquinone oxidoreductase complex, indicating cross-talk between ETC components .

Pathogenicity and Host Interaction
While petA itself is not directly implicated in virulence, its role in energy production supports R. typhi’s intracellular replication. Studies in Rickettsia conorii and R. rickettsii highlight the importance of ETC proteins in pathogenicity .

Applications in Research and Diagnostics

Diagnostic Tools
Recombinant petA is used in ELISA kits for detecting anti-Rickettsia antibodies, leveraging its immunogenic properties. For example:

ApplicationDetails
ELISA KitsQuantitative detection of R. typhi-specific antibodies in clinical samples
Antigenic EpitopesPassenger domain (aa 36–1334) may serve as targets for immune responses

Vaccine Development
PetA’s conservation across Rickettsia species positions it as a candidate for broad-spectrum vaccine antigens, though no clinical trials have been reported .

Potential as a Drug Target

Rationale for Targeting
PetA’s essential role in Rickettsia metabolism makes it a viable target. In Rickettsia felis, succinate dehydrogenase (a petA interaction partner) was identified as a druggable target, with inhibitors like ZINC67974679 showing promise .

Challenges

  • Host Homology: Avoiding cross-reactivity with human proteins (e.g., mitochondrial ETC components).

  • Resistance: Rickettsia’s reductive genome evolution may limit target diversity .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; RT0261; Ubiquinol-cytochrome c reductase iron-sulfur subunit; Rieske iron-sulfur protein; RISP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Target Names
petA
Target Protein Sequence
MSDTEDNRNKQTTRRDFIVLTASSVAAVGAACAFWPIIDSLNPSTDVLALSSIEVDLSSI AIGQTVTVKWQGKPIFITNRTPDGIASARAVKMSELIDPEKDEVRVKAGHDNWLVTIGIC THLGCVPLSNQGEYNGWFCPCHGSQYDSSGRVRKGPASLNLVVPPYIFISDTKIRIG
Uniprot No.

Target Background

Function
A component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome bc1 complex), a respiratory chain enzyme critical for generating the electrochemical potential necessary for ATP synthesis.
Database Links

KEGG: rty:RT0261

STRING: 257363.RT0261

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant Rickettsia typhi petA?

When expressing recombinant R. typhi petA, researchers should consider the following methodological approaches:

  • E. coli expression systems:

    • BL21(DE3) strain with pET vector systems shows high expression levels

    • Use of fusion tags (His6, GST, or MBP) improves solubility

    • Codon optimization is essential due to the AT-rich nature of Rickettsia genomes (28.9% GC content)

    • Expression at lower temperatures (16-25°C) reduces inclusion body formation

  • Insect cell expression systems:

    • Baculovirus expression in Sf9 or High Five cells preserves protein folding

    • More suitable for maintaining proper iron-sulfur cluster incorporation

  • Cell-free expression systems:

    • Allow for controlled redox environments necessary for iron-sulfur cluster formation

    • Enable direct incorporation of labeled amino acids for structural studies

Purification typically involves affinity chromatography followed by size exclusion chromatography. For recombinant petA protein, storage should include 50% glycerol in Tris-based buffer at -20°C or -80°C for extended storage .

How can recombinant petA be used for studying Rickettsia typhi infection dynamics?

Recombinant petA can serve as a valuable tool for studying R. typhi infection through several methodological approaches:

  • Serological detection:

    • Development of ELISA assays using recombinant petA as antigen

    • Monitoring antibody responses in infected hosts

    • Differentiating between active and past infections based on antibody kinetics

  • Cellular localization studies:

    • Fluorescently labeled recombinant petA for tracking protein distribution

    • Immunofluorescence assays to examine protein expression during different infection stages

  • Host-pathogen interaction analysis:

    • Pull-down assays using recombinant petA to identify host binding partners

    • Analysis of protein-protein interactions in the context of bacterial invasion

Studies have shown various seroprevalence rates for R. typhi antibodies across different regions. For example, research in Japan showed seroprevalence ratios of R. typhi compared to O. tsutsugamushi of 1.63 (95% CI: 1.32–2.00) in Otaki, 1.05 (95% CI: 0.73–1.50) in Katsuura, and 1.23 (95% CI: 0.79–1.92) in Kameda .

What are the challenges in maintaining stability of recombinant Rickettsia typhi petA?

Maintaining stability of recombinant R. typhi petA presents several challenges:

  • Iron-sulfur cluster integrity:

    • Methodological approach: Use anaerobic purification techniques

    • Include reducing agents (DTT, β-mercaptoethanol) in buffers

    • Monitor Fe-S integrity through UV-Vis spectroscopy at 320-460 nm

  • Protein aggregation:

    • Methodological approach: Addition of stabilizing agents (glycerol, sucrose)

    • Optimization of buffer conditions (pH 7.0-8.0 typically optimal)

    • Storage at -80°C in single-use aliquots to prevent freeze-thaw degradation

  • Oxidative damage:

    • Methodological approach: Include antioxidants like ascorbic acid

    • Avoid exposing protein to air for extended periods

    • Use oxygen-scavenging enzyme systems during long experiments

For optimal storage conditions, the protein should be kept in Tris-based buffer with 50% glycerol at -20°C, and for extended storage at -80°C . Stability assessments can be performed using activity assays measuring electron transfer capacity or structural integrity through circular dichroism spectroscopy.

How does petA contribute to the pathogenesis mechanisms of Rickettsia typhi?

The contribution of petA to R. typhi pathogenesis involves complex interactions with host metabolism and immune responses:

  • Energy metabolism during infection:

    • petA function ensures efficient ATP production critical for bacterial replication

    • Methodological approach: Generate energy metabolism profiles using metabolomics during infection with wild-type vs. petA-modified R. typhi

    • Research finding: Energy disruption in bacteria through targeting electron transport components increases host cell survival

  • Immune recognition and evasion:

    • petA may serve as a pathogen-associated molecular pattern (PAMP) recognized by host immunity

    • Methodological approach: Examine cytokine profiles after exposure to purified recombinant petA

    • Research finding: Surface-exposed bacterial proteins often elicit strong immune responses, contributing to both protection and immunopathology

  • Host cell interaction network:

    • Potential non-canonical roles beyond electron transport

    • Methodological approach: Proteomics analysis of host proteins co-immunoprecipitating with petA

    • Research finding: Some metabolic proteins in bacteria have moonlighting functions in pathogenesis

Research has shown that obligate intracellular bacteria like R. typhi have evolved mechanisms to exploit host resources while avoiding immune recognition . The petA protein may play a dual role in both energy metabolism and host interaction, representing a potential target for therapeutic intervention.

What structural and functional differences exist between petA in Rickettsia typhi and homologous proteins in other bacteria?

The structural and functional comparison of petA across bacterial species reveals important evolutionary adaptations:

The compact genome of R. typhi (0% repetitive content by some measures ) suggests evolutionary pressure to maintain only essential functions, making petA's conservation significant in understanding the organism's biology.

What are the latest techniques for genetic manipulation of petA in Rickettsia typhi?

Genetic manipulation of Rickettsia remains challenging, but recent methodological advances have improved our ability to study genes like petA:

  • Transposon-based mutagenesis:

    • Methodology: mariner-based transposon systems adapted for Rickettsia

    • Research finding: The first large-scale rickettsial mutant collection was published in 2018 using R. parkeri, isolating over 100 mutants with defects in mammalian cell infection

    • Application: Random insertion libraries can identify petA phenotypes if the gene is non-essential or conditionally essential

  • Targeted gene modification:

    • Methodology: Group II intron retrohoming (TargeTron) has been demonstrated in R. rickettsii

    • Research finding: This technique has been successfully used to knock out ompA in R. rickettsii

    • Application: Could potentially be adapted for petA modification with appropriate targeting sequences

  • Gene silencing approaches:

    • Methodology: Peptide nucleic acids (PNAs) for gene silencing

    • Research finding: PNAs have been used to reduce expression of ompB and rickA genes in R. typhi

    • Application: PNA design targeting petA mRNA could provide a knockdown approach when knockout is lethal

  • Complementation strategies:

    • Methodology: Shuttle vectors developed for Rickettsiae in 2011

    • Research finding: The first genetic complementation of a rickettsial mutant with a native promoter was achieved in 2016

    • Application: Essential for confirming phenotypes observed in petA mutants

These genetic tools face significant challenges due to the obligate intracellular nature of Rickettsia, but represent important methodological advances for future petA research.

How can systems biology approaches integrate petA function into the broader metabolic network of Rickettsia typhi?

Systems biology offers comprehensive frameworks to understand petA's role in the broader context of R. typhi metabolism:

  • Metabolic network reconstruction:

    • Methodology: Genome-scale metabolic modeling incorporating electron transport components

    • Research finding: The electron transport chain represents a critical hub in obligate intracellular bacteria with streamlined metabolic networks

    • Application: Identifying metabolic dependencies and potential drug targets connected to petA function

  • Multi-omics integration:

    • Methodology: Combining transcriptomics, proteomics, and metabolomics data

    • Application: Reveals context-dependent regulation of petA and associated pathways

  • Flux balance analysis:

    • Methodology: Mathematical modeling of metabolic fluxes under different conditions

    • Research finding: Electron transport components like petA often represent critical control points in metabolic networks

    • Application: Predicting system-wide effects of petA inhibition

Protein-protein interaction (PPI) analysis has shown that succinate dehydrogenase interacts with ubiquinol-cytochrome reductase (petA), NADH dehydrogenase, and other components of the electron transport chain , highlighting the integrated nature of these systems in Rickettsia metabolism.

What is the potential of petA as a drug target for treating Rickettsia typhi infections?

The evaluation of petA as a potential drug target involves several methodological considerations:

  • Target validation approaches:

    • Methodology:

      • Genetic knockdown/knockout studies to assess essentiality

      • In vitro inhibition studies with electron transport inhibitors

      • Infection model testing with petA-specific inhibitors

    • Research finding: Components of the electron transport chain often represent essential functions with limited redundancy in bacterial pathogens

  • Structure-based drug design:

    • Methodology:

      • Homology modeling based on crystallized homologs

      • Molecular docking of compound libraries

      • Fragment-based screening approaches

    • Research approach: Virtual screening of approximately 18,000 ZINC compounds against related targets has identified promising inhibitors in other studies

  • Drug candidate evaluation metrics:

    • Methodology: ADMET (absorption, distribution, metabolism, excretion, toxicity) profiling

    • Research consideration: The intracellular location of R. typhi requires drugs that can penetrate host cell membranes

  • Resistance development assessment:

    • Methodology: Serial passage experiments with sub-inhibitory concentrations

    • Research finding: Antibiotic resistance in rickettsiae can be readily evolved in laboratory culture and has been found in natural isolates

Table: Comparison of potential target characteristics:

CharacteristicpetA (Ubiquinol-cytochrome c reductase)Other Potential Targets
EssentialityHigh (electron transport)Variable
ConservationHighly conserved across RickettsiaVariable conservation
DruggabilityDemonstrated for homologsTarget-dependent
Host homologPresent but sufficiently differentVariable similarity
Resistance barrierPotentially high due to essential functionVaries by mechanism

The succinate dehydrogenase complex, which interacts with petA, has emerged as a promising drug target through rigorous screening processes and extensive literature review in recent studies .

How can the immune response against petA be leveraged for diagnostic or vaccine development?

Leveraging immune responses against petA for clinical applications involves several methodological considerations:

  • Diagnostic development:

    • Methodology:

      • ELISA assays using recombinant petA as antigen

      • Multiplex serological assays incorporating petA with other immunogenic proteins

      • Lateral flow immunochromatographic tests for point-of-care detection

    • Research finding: Seroprevalence studies for R. typhi have shown varying rates across different regions, with one study showing seroprevalence of 11.3% (95% CI: 10.0-12.6%) using a 1:40 antibody cutoff titer

  • Epitope mapping:

    • Methodology:

      • Peptide scanning arrays to identify immunodominant regions

      • B-cell and T-cell epitope prediction algorithms

      • Validation using serum from confirmed cases

    • Research consideration: Surface-exposed regions of petA are likely to be more immunogenic and accessible to antibodies

  • Vaccine design strategies:

    • Methodology:

      • Subunit vaccine approaches using recombinant petA

      • DNA vaccine encoding petA

      • Epitope-based vaccines focusing on immunodominant regions

    • Research consideration: Cytotoxic CD8+ T cells are crucial for establishing protective immunity against Rickettsia species , making T-cell epitopes particularly important

  • Cross-protection assessment:

    • Methodology: Evaluation of immune responses against homologous proteins from different Rickettsia species

    • Research approach: Testing whether antibodies against R. typhi petA cross-react with proteins from other species like R. prowazekii or R. rickettsii

The potential of petA as a target for both diagnostics and vaccines remains largely unexplored but warrants investigation given the challenges in diagnosing and preventing rickettsial diseases.

What technical challenges exist in studying protein-protein interactions involving petA in Rickettsia typhi?

Investigating protein-protein interactions (PPIs) involving petA in R. typhi presents unique technical challenges that require specialized methodological approaches:

  • Membrane protein interaction analysis:

    • Challenge: petA is a membrane-associated protein with hydrophobic domains

    • Methodological approach:

      • Membrane yeast two-hybrid systems

      • Bioluminescence resonance energy transfer (BRET)

      • Cross-linking mass spectrometry with membrane-compatible reagents

    • Research consideration: Detergent selection is critical for maintaining native interactions

  • Host-pathogen interaction mapping:

    • Challenge: Capturing transient interactions in the intracellular environment

    • Methodological approach:

      • Proximity-dependent biotin labeling (BioID, TurboID)

      • Split reporter complementation assays

      • Co-immunoprecipitation with stabilizing crosslinkers

    • Research finding: The protein-protein interaction analysis has shown that succinate dehydrogenase interacts with ubiquinol-cytochrome reductase (petA)

  • In situ validation of interactions:

    • Challenge: Confirming interactions in the native context

    • Methodological approach:

      • Förster resonance energy transfer (FRET) microscopy

      • Fluorescence correlation spectroscopy

      • Proximity ligation assays

    • Research consideration: Requires genetic manipulation of Rickettsia to introduce tagged proteins

  • Low abundance protein detection:

    • Challenge: petA may be expressed at low levels, making detection difficult

    • Methodological approach:

      • Targeted mass spectrometry (MRM/PRM)

      • Signal amplification techniques

      • Super-resolution microscopy for spatial mapping

    • Research consideration: Sensitivity must be balanced with specificity to avoid false positives

Overcoming these challenges will be essential for understanding how petA functions within the complex network of interactions that enable R. typhi to survive as an obligate intracellular pathogen.

How do post-translational modifications affect petA function in Rickettsia typhi?

The analysis of post-translational modifications (PTMs) of petA requires specialized methodologies:

  • Identification of PTM sites:

    • Methodology:

      • Mass spectrometry-based PTM mapping

      • Enrichment techniques for specific modifications

      • Site-directed mutagenesis to confirm functional impact

    • Research consideration: Common PTMs may include phosphorylation, acetylation, and iron-sulfur cluster modifications

  • Functional impact assessment:

    • Methodology:

      • Activity assays comparing modified and unmodified forms

      • Structural analysis to determine conformational changes

      • Time-course analysis of PTM dynamics during infection

    • Research consideration: PTMs may regulate electron transfer efficiency or protein-protein interactions

  • Host-induced modifications:

    • Methodology:

      • Comparative analysis of petA modifications in different host cell types

      • Inhibitor studies targeting host enzymes that modify bacterial proteins

      • Immunoprecipitation of petA from infected cells at different timepoints

    • Research consideration: Host-induced modifications could represent defense mechanisms or pathogen manipulation

  • Iron-sulfur cluster biogenesis:

    • Methodology:

      • In vitro reconstitution of Fe-S clusters

      • Mössbauer spectroscopy to characterize iron states

      • Analysis of iron-sulfur cluster assembly proteins

    • Research finding: The iron-sulfur clusters in petA are essential for electron transport function and represent a specialized form of post-translational modification

Understanding these modifications will provide insights into the dynamic regulation of petA function during the intracellular lifecycle of R. typhi.

What methods are most effective for studying electron transport chain activity involving petA in Rickettsia typhi?

Studying electron transport chain (ETC) activity in R. typhi requires specialized methodological approaches:

  • Membrane potential measurements:

    • Methodology:

      • Fluorescent probes sensitive to membrane potential (DiOC6, JC-1)

      • Patch-clamp electrophysiology of isolated bacterial membranes

      • Real-time monitoring during infection of host cells

    • Research consideration: Changes in membrane potential directly reflect ETC activity

  • Oxygen consumption analysis:

    • Methodology:

      • High-resolution respirometry

      • Extracellular flux analysis (Seahorse technology)

      • Oxygen-sensitive phosphorescent probes

    • Research finding: Oxygen consumption rates provide direct measurement of electron transport to the terminal oxidase

  • Specific complex III activity assays:

    • Methodology:

      • Spectrophotometric tracking of cytochrome c reduction

      • Enzyme-coupled assays with artificial electron donors/acceptors

      • Inhibitor studies using specific complex III inhibitors

    • Research consideration: Must distinguish bacterial from host cell ETC activity

  • Redox state analysis:

    • Methodology:

      • NAD+/NADH ratio determination

      • Glutathione redox state measurement

      • Redox-sensitive fluorescent proteins expressed in bacteria

    • Research finding: Redox states provide insights into electron flow through the ETC

  • In vivo imaging approaches:

    • Methodology:

      • Genetically encoded redox sensors

      • Multi-parameter imaging of infected cells

      • Correlative light and electron microscopy

    • Research consideration: Requires genetic manipulation of Rickettsia

These methodologies provide complementary approaches to understand the role of petA in R. typhi energy metabolism, which is critical for bacterial survival and replication within host cells.

How can comparative genomics inform our understanding of petA evolution and function across Rickettsia species?

Comparative genomic approaches provide valuable insights into petA evolution and function:

  • Phylogenetic analysis:

    • Methodology:

      • Maximum likelihood or Bayesian phylogenetic reconstruction

      • Selection pressure analysis (dN/dS ratios)

      • Ancestral sequence reconstruction

    • Research finding: Unlike the surface proteins rOmpA and rOmpB which are subject to intense positive natural selection, genes involved in basic metabolic functions tend to be more conserved

  • Genomic context analysis:

    • Methodology:

      • Evaluation of gene neighborhood conservation

      • Operon structure comparison across species

      • Regulatory element identification

    • Research finding: The R. typhi genome has undergone reductive evolution resulting in a compact, non-repetitive genome (0% repetitive by some measures)

  • Horizontal gene transfer detection:

    • Methodology:

      • Anomalous sequence composition analysis

      • Phylogenetic incongruence testing

      • Recombination detection methods

    • Research finding: Evidence of recombination between species has been observed in Rickettsia, though recombination has been sufficiently infrequent that gene phylogenies remain largely consistent

  • Structure-function correlation across species:

    • Methodology:

      • Mapping of conserved vs. variable regions onto structural models

      • Identification of species-specific adaptations

      • Correlation with host range and pathogenicity

    • Research consideration: Variations in petA structure may reflect adaptation to different arthropod vectors or vertebrate hosts

Table: Genomic features comparison across Rickettsia species:

SpeciesGenome SizeGC ContentpetA Gene PresentNotes
R. typhi1.1 Mbp28.9%YesTyphus group
R. prowazekii1.1 Mbp29.0%YesTyphus group
R. rickettsii1.3 Mbp32.5%YesSpotted fever group
R. felis1.5 Mbp32.5%YesTransitional group
R. bellii1.5 Mbp31.6%YesAncestral group

This comparative approach reveals how metabolic functions like electron transport have been maintained even as Rickettsia genomes have undergone substantial reduction during adaptation to obligate intracellular lifestyles.

How can recombinant petA be used to develop novel diagnostic tools for Rickettsia typhi infections?

Developing diagnostics using recombinant petA involves several methodological approaches:

  • Serological assay development:

    • Methodology:

      • ELISA optimization with different coating buffers and blocking agents

      • Western blot analysis for confirmation of specific binding

      • Multiplex bead-based immunoassays incorporating multiple antigens

    • Research consideration: Current diagnostic methods for rickettsial diseases have low sensitivity and specificity

  • Point-of-care test development:

    • Methodology:

      • Lateral flow immunochromatographic assays

      • Microfluidic devices with integrated detection

      • Smartphone-based colorimetric analysis

    • Research finding: Early diagnosis is critical as mortality rates for typhus group rickettsiae can reach 60% without treatment

  • Molecular detection approaches:

    • Methodology:

      • Loop-mediated isothermal amplification (LAMP) targeting petA gene

      • Recombinase polymerase amplification

      • CRISPR-Cas-based detection systems

    • Research finding: A LAMP assay for R. rickettsii showed high specificity when tested against multiple Rickettsia species including R. typhi

  • Biomarker identification:

    • Methodology:

      • Profiling of antibody responses to petA epitopes during infection

      • Identification of infection-specific modifications

      • Correlating anti-petA antibody levels with disease severity

    • Research consideration: The unique epitopes in petA may allow differentiation between Rickettsia species

The development of new diagnostic methods is crucial given the challenging nature of clinical diagnosis for rickettsial diseases and the importance of early treatment.

What are the future prospects for targeting petA in Rickettsia typhi therapeutic development?

The development of therapeutics targeting petA involves several methodological considerations:

  • Small molecule inhibitor development:

    • Methodology:

      • High-throughput screening of chemical libraries

      • Structure-based drug design using homology models

      • Fragment-based drug discovery approaches

    • Research finding: Previous studies have identified promising inhibitors of electron transport components in related systems

  • Peptide-based inhibitor design:

    • Methodology:

      • Identification of protein-protein interaction interfaces

      • Cyclic peptide development to disrupt essential interactions

      • Cell-penetrating peptide conjugation for delivery

    • Research consideration: Must ensure targeting specificity and cellular penetration

  • Alternative therapeutic approaches:

    • Methodology:

      • Antisense oligonucleotides targeting petA mRNA

      • CRISPR-Cas delivery systems for gene editing

      • Host-directed therapies that affect dependency on bacterial ETC

    • Research finding: Current treatment relies primarily on tetracycline antibiotics, with limited alternatives

  • Combination therapy strategies:

    • Methodology:

      • Synergy testing with existing antibiotics

      • Multi-target approaches affecting related metabolic pathways

      • Host-pathogen interface targeting

    • Research consideration: The rise in antibiotic-resistant strains underscores the need for new therapeutic interventions

Given the increasing prevalence of rickettsial diseases and concerns about antibiotic resistance, developing alternative therapeutic strategies targeting essential proteins like petA represents an important research direction.

How might advances in structural biology techniques improve our understanding of petA function?

Cutting-edge structural biology methodologies offer promising approaches to understand petA function:

  • Cryo-electron microscopy (cryo-EM):

    • Methodology:

      • Single-particle analysis of purified petA-containing complexes

      • Subtomogram averaging of complexes in situ

      • Time-resolved cryo-EM to capture conformational changes

    • Research consideration: Recent advances allow near-atomic resolution of membrane protein complexes

  • Integrative structural biology:

    • Methodology:

      • Combining X-ray crystallography, NMR, and computational modeling

      • Cross-linking mass spectrometry to define interaction interfaces

      • Small-angle X-ray scattering for solution-state conformations

    • Research consideration: Multiple techniques overcome limitations of individual methods

  • Molecular dynamics simulations:

    • Methodology:

      • Atomistic simulations of petA within membrane environment

      • Coarse-grained approaches for longer timescale events

      • Free energy calculations for ligand binding and protein-protein interactions

    • Research consideration: Computational approaches provide insights into dynamic processes difficult to capture experimentally

  • In-cell structural biology:

    • Methodology:

      • In-cell NMR for studying petA in its native environment

      • Fluorescence-detected structural changes

      • Correlative light and electron microscopy

    • Research consideration: Provides structural insights in physiologically relevant contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.