Recombinant Rickettsia typhi Uncharacterized protein RT0031 (RT0031)

Shipped with Ice Packs
In Stock

Description

Functional Insights and Pathogenic Relevance

While RT0031’s exact role remains uncharacterized, proteomic studies indicate it localizes to the bacterial surface, implicating potential involvement in:

  • Host cell adhesion: Surface-exposed proteins like Sca family members mediate rickettsial invasion .

  • Immune evasion: RT0031 may interact with host factors akin to OmpB, which modulates autophagy and inflammasome responses .

  • Antigenic potential: Recombinant RT0031 could serve as a diagnostic target, similar to methylated OmpB fragments used in serological assays .

Notably, R. typhi surface proteins are under positive selection, hinting at RT0031’s evolutionary adaptability .

Research Applications

RT0031 has been utilized in:

3.1. Pathogenesis Studies

  • Autophagy modulation: R. typhi surface proteins evade lysosomal degradation via ubiquitination pathways .

  • Immune response profiling: Recombinant proteins enable epitope mapping for vaccine development .

3.2. Diagnostic Development

  • Serological testing: Refolded RT0031 fragments could replace whole-cell antigens in ELISA .

Comparative Genomic Context

The RT0031 gene resides in a genomic region prone to rearrangements across Rickettsia species . Unlike R. prowazekii, R. typhi lacks a 12-kb insertion near the replication terminus, preserving RT0031’s sequence integrity . This conservation suggests functional indispensability despite its uncharacterized status.

Limitations and Future Directions

  • Functional annotation: No interaction partners or enzymatic activity have been validated .

  • Structural data: Tertiary structure predictions require experimental validation via cryo-EM or X-ray diffraction.

  • Immunogenicity: Methylation patterns (critical for antigenicity in OmpB) remain unexplored in RT0031 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this need in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
RT0031; Uncharacterized protein RT0031
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-674
Protein Length
Full Length of Mature Protein
Species
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Target Names
RT0031
Target Protein Sequence
GFGESCSNLPITSDGYLETYTAYGYIIRSIDMKDPRGNCNPYTSSITFCFKNVEGSTSPC TIYTLNEGDARKISDLSTDNNPNLGANTVLKNIVLTVKKFGNDLCLAMPTSRGPMPVACK SLNATPAPTNPKYENCNIGKSCYTGANYSQSLINFSGLAVQCLSETLNKIFFTGNSCSSQ DQNSRITHLAAFSTFQGYLKRIIGAALILYTMFFAFNMALNKEYATTEKITLFIIKFLFV VYFSIGLEPLNFSGGQTVKENGMLKYGLPLLTGAAPDFAEMIFNAAGSRGLCQFDNSKYK DGYKFYGLWDAIDCRIGYYLGLDLLYNIDKNGILGHSVGNGPGGNNKPIPNFDPDSKKDR PHDLSKAGALRFFTVMFGFLMSGHIIILVAGIAFSVIFLSILLYFITHYLVCMITIYVMT YISPIFIPMVLFTRTKAYFDGWVKVCISCALQPAVVAGFIALLITMYDSAIFKNCEFLRY DYEKGDIRFSTFELRLPSIDADKCQESFGYKMLKYYAGEGWEEHLLILFPIKSIVRDVVS ILAELLCVLVFSVIFYYFSKSIGRFAADLTNGPNMDAVTASPTKIVDLVKKGAAFLQDAS SVHAQGKSPVEDKPDIGSKRKDGVQQGEDSENSSGGELADLASGSGGGKL
Uniprot No.

Target Background

Database Links

KEGG: rty:RT0031

STRING: 257363.RT0031

Protein Families
TrbL/VirB6 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What experimental designs are optimal for functional characterization of RT0031?

Given that RT0031 is an uncharacterized protein, a systematic experimental design approach is recommended for functional characterization:

Multi-level Experimental Framework:

  • Bioinformatic Analysis:

    • Sequence homology comparisons with characterized proteins

    • Domain prediction and structural modeling

    • Prediction of post-translational modifications and functional sites

  • Subcellular Localization:

    • Fluorescent tagging (GFP fusion) for visualization in cell models

    • Subcellular fractionation followed by Western blot analysis

    • Immunogold electron microscopy for precise localization

  • Protein-Protein Interaction Studies:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation with potential interacting partners

    • Proximity labeling methods (BioID or APEX)

    • Surface plasmon resonance for binding kinetics

  • Functional Assays:

    • Gene knockout/knockdown studies in model systems

    • Complementation assays to restore phenotypes

    • Site-directed mutagenesis of predicted functional residues

The experimental design should incorporate proper controls and follow a true experimental design framework with independent variables (e.g., different conditions, mutations, or interacting proteins) and dependent variables (e.g., binding affinity, cellular phenotypes) . Given the transmembrane nature of RT0031, special consideration should be given to maintaining membrane protein integrity throughout experimental procedures.

A factorial experimental design would be particularly valuable for testing multiple variables simultaneously, allowing for the detection of interaction effects between different factors affecting RT0031 function .

  • How can contradictions in RT0031 experimental data be analyzed and resolved?

When confronted with contradictory experimental results regarding RT0031, researchers should employ a systematic approach to data contradiction analysis:

Contradiction Resolution Framework:

  • Typology of Contradictions:

    • Identify whether contradictions are numerical, lexical, or structural in nature

    • Classify contradictions as either direct oppositions (A vs. not-A) or incompatible values

  • Experimental Variables Analysis:

    • Examine differences in experimental conditions (temperature, pH, buffer composition)

    • Evaluate protein preparation methods (tags, expression systems, purification protocols)

    • Compare cell or tissue types used across studies

  • Methodological Assessment:

    • Analyze sensitivity and specificity of detection methods

    • Evaluate the statistical power and analysis methods used

    • Consider the temporal aspects of measurements

  • Structured Representation of Contradictions:

    • Use a notation system such as (α, β, θ), where α represents the number of interdependent items, β the number of contradictory dependencies, and θ the minimum number of Boolean rules needed to assess these contradictions

  • Resolution Strategies:

    • Design confirmatory experiments with stricter controls

    • Perform meta-analysis of existing data with weighted significance

    • Develop hybrid models that can accommodate seemingly contradictory results

As noted by Marie-Catherine de Marneffe et al., contradictions in scientific data often arise from updated information as knowledge evolves or from divergent interpretations of similar phenomena . For RT0031, these contradictions might reflect the protein's context-dependent functions or structural variations that manifest differently under various experimental conditions.

  • What are the methodological considerations for studying protein-protein interactions involving RT0031?

Investigating protein-protein interactions (PPIs) involving membrane proteins like RT0031 requires specialized methodological approaches:

Key Methodological Considerations:

  • Protein Preparation:

    • Use detergent solubilization methods compatible with membrane proteins

    • Consider nanodiscs or liposome reconstitution to maintain native membrane environment

    • Evaluate tag position (N- or C-terminal) to avoid interference with interaction domains

  • Interaction Detection Methods:

    MethodAdvantagesLimitationsConsiderations for RT0031
    Yeast Two-HybridHigh-throughput, in vivoPoor for membrane proteinsConsider split-ubiquitin membrane Y2H variant
    Co-ImmunoprecipitationDetects complexes in near-native conditionsRequires antibodies, may disrupt weak interactionsUse crosslinking to stabilize transient interactions
    Surface Plasmon ResonanceReal-time kinetics, no labels requiredRequires protein immobilizationCarefully orient RT0031 to expose interaction domains
    Proximity Labeling (BioID)Identifies interactions in native cellular contextMay identify proximal but non-interacting proteinsUseful for mapping RT0031's interaction neighborhood
  • Controls and Validation:

    • Include well-characterized protein pairs as positive controls

    • Use scrambled peptides or unrelated proteins as negative controls

    • Validate interactions through orthogonal methods

    • Perform reciprocal pull-downs to confirm specificity

  • Data Analysis:

    • Apply appropriate statistical methods for evaluating significance of interactions

    • Use computational modeling to predict interaction interfaces

    • Consider context dependency of interactions (pH, ionic strength, etc.)

  • Functional Validation:

    • Perform mutagenesis of predicted interaction sites

    • Evaluate phenotypic consequences of disrupting specific interactions

    • Assess competition between potential binding partners

For transmembrane proteins like RT0031, conventional methods may require modification. For example, membrane-based two-hybrid systems or split-GFP complementation assays might be more suitable than classical yeast two-hybrid approaches .

  • How can RT0031 be used in comparative studies with other Rickettsia species proteins?

Comparative studies between RT0031 and homologous proteins from other Rickettsia species can provide valuable insights into protein function and evolution:

Comparative Research Framework:

  • Homology Identification:

    • Perform BLAST searches against other Rickettsia genomes

    • Identify orthologs and paralogs across species

    • Construct phylogenetic trees to visualize evolutionary relationships

  • Sequence and Structure Comparison:

    • Conduct multiple sequence alignments to identify conserved residues

    • Map conservation onto predicted structural models

    • Identify species-specific insertions, deletions, or substitutions

  • Comparative Expression Analysis:

    • Compare expression patterns across species under various conditions

    • Analyze promoter regions for regulatory differences

    • Examine codon usage and optimize recombinant expression accordingly

  • Functional Comparative Studies:

    • Express orthologous proteins from different Rickettsia species

    • Compare biochemical properties (stability, binding affinities, enzymatic activities)

    • Perform complementation assays across species

  • Experimental Design Considerations:

    • Use standardized experimental protocols to minimize methodology-based variations

    • Express proteins in the same system with identical tags

    • Perform parallel analyses under identical conditions

    • Include appropriate statistical methods for multi-species comparisons

This comparative approach can be particularly valuable for generating hypotheses about RT0031 function based on better-characterized homologs in other species. It may also reveal species-specific adaptations that contribute to the unique pathogenic properties of different Rickettsia species .

  • What are the current research gaps in understanding RT0031 function?

Despite the availability of recombinant RT0031 for research purposes, significant knowledge gaps remain:

Key Research Gaps and Future Directions:

  • Structural Characterization:

    • High-resolution crystal or cryo-EM structure determination

    • Membrane topology mapping

    • Structural dynamics under different conditions

  • Functional Annotation:

    • Definitive biochemical function identification

    • Enzymatic activity characterization, if any

    • Role in Rickettsia typhi pathogenesis and life cycle

  • Interaction Networks:

    • Comprehensive interactome mapping

    • Host-pathogen interaction identification

    • Temporal dynamics of protein interactions during infection

  • Regulation and Expression:

    • Transcriptional and translational regulation mechanisms

    • Post-translational modifications and their functional significance

    • Expression patterns during different stages of bacterial life cycle

  • Therapeutic Potential:

    • Evaluation as a potential drug target

    • Development of inhibitors or blocking antibodies

    • Assessment of immunogenicity and vaccine potential

Addressing these gaps requires a multi-disciplinary approach combining structural biology, biochemistry, cell biology, and systems biology methodologies. Collaborative research involving experts in Rickettsia biology, protein biochemistry, and structural biology would be particularly valuable .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.