Recombinant Rickettsia typhi Uncharacterized protein RT0683 (RT0683)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1–1.0 mg/mL. We recommend adding 5–50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RT0683; Uncharacterized protein RT0683
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Target Names
RT0683
Target Protein Sequence
MIKLKSILNFLYNIANKDGFKGYKECRTSAYKNVFDDSSTKSTSKFHLGISDTKNLLSLQ NIIGLILIIFAGVLFYAYILQHEWRYVTLSDAQVKRYRISEKKALSLYQLMKDTHELLTK NNIKYWIESGTLLGAVRHQGIIPFDDDLDIGIMHEDEIHFQQILPQFKQLGYRIKHNKIY VICGERCLDIFIFHKEKDKFVHILYDQYPNDFFYENELYPLKKYKFGNIEVYGPFDPIGN LNRQYPEWDKYAIIYSPHSFHLLFLSNIEKKTKFILTPELLKPAQPFGPLKDKVNIVNSA NIYNDMDYH
Uniprot No.

Target Background

Database Links

KEGG: rty:RT0683

STRING: 257363.RT0683

Protein Families
LicD transferase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How is recombinant RT0683 typically expressed and purified?

Recombinant RT0683 is commonly expressed in E. coli expression systems using plasmid vectors that allow for fusion with affinity tags like the N-terminal His-tag . The typical methodology includes:

  • Cloning the full-length gene (encoding amino acids 1-309) into an expression vector

  • Transformation into competent E. coli cells

  • Induction of protein expression (often using IPTG for lac promoter systems)

  • Cell lysis and initial clarification of lysate

  • Affinity chromatography using Ni-NTA or similar resin for His-tagged protein

  • Further purification steps as needed (ion exchange or size exclusion chromatography)

  • Concentration and buffer exchange to a suitable storage buffer (often Tris/PBS-based with trehalose)

The purified protein is typically obtained with >90% purity as determined by SDS-PAGE .

What are the recommended storage conditions for recombinant RT0683?

For optimal stability and activity of recombinant RT0683, the following storage conditions are recommended based on experimental evidence:

Storage ConditionRecommendationNotes
Short-term storage4°CUp to one week for working aliquots
Long-term storage-20°C to -80°CAliquoting is necessary to avoid freeze-thaw cycles
FormulationTris/PBS-based buffer with 6% trehalose (pH 8.0)Alternative: 50% glycerol in appropriate buffer
Reconstitution0.1-1.0 mg/mL in deionized sterile waterAddition of 5-50% glycerol recommended for aliquots

Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein stability and activity .

How should I design experiments to investigate potential functions of RT0683?

Since RT0683 remains uncharacterized, a systematic approach to functional investigation would include:

  • Bioinformatic analysis:

    • Sequence homology searches against characterized proteins

    • Identification of conserved domains and motifs

    • Prediction of secondary structure and transmembrane regions

    • Phylogenetic analysis compared to other Rickettsia proteins

  • Expression studies:

    • Determine expression levels during different growth phases of R. typhi

    • Use RT-PCR and Western blotting to detect transcript and protein levels

    • Compare with known patterns of characterized virulence factors

  • Localization studies:

    • Generate antibodies against recombinant RT0683

    • Perform immunofluorescence assays to determine subcellular localization

    • Assess potential secretion into host cells during infection (similar to Pat1/Pat2 proteins)

  • Functional assays:

    • Test for common enzymatic activities (e.g., phospholipase activity)

    • Assess cytotoxicity in yeast and mammalian cells (as done for Pat1/Pat2)

    • Examine effects on host cell invasion and phagosomal escape

  • Knockout/knockdown studies:

    • Generate deletion mutants if genetic systems are available

    • Use antibodies for neutralization studies to assess role in infection

This approach parallels successful strategies used to characterize other Rickettsia proteins like RT0522 (Pat2) .

What are the key considerations for developing antibodies against RT0683?

Developing specific antibodies against RT0683 requires careful planning:

  • Antigen preparation:

    • Use highly purified recombinant protein (>90% purity)

    • Consider using both full-length protein and peptide epitopes

    • Ensure proper folding of recombinant protein or use denatured protein depending on intended use

  • Immunization protocol:

    • Follow established protocols with appropriate adjuvants

    • Use multiple animals for polyclonal antibody production

    • For monoclonal antibodies, screen hybridomas thoroughly

  • Antibody validation steps:

    • ELISA against recombinant protein

    • Western blot analysis against recombinant protein and R. typhi lysates

    • Immunofluorescence assays with R. typhi-infected cells

    • Preabsorption controls to confirm specificity

    • Cross-reactivity assessment with other Rickettsia species proteins

  • Application-specific considerations:

    • For neutralization studies: use purified IgG and appropriate controls (pre-immune IgG)

    • For immunolocalization: optimize fixation and permeabilization conditions

    • For immunoprecipitation: validate under native and denaturing conditions

The developed antibodies could be valuable tools for studying protein function in R. typhi infection, similar to antibody studies performed with Pat1 and Pat2 proteins .

How does RT0683 compare to known virulence factors in Rickettsia species?

Unlike well-characterized Rickettsia virulence factors, RT0683 remains functionally uncharacterized. Comparative analysis shows:

ProteinFunctionSecretionRole in PathogenesisConservation
RT0683 (Uncharacterized)UnknownUnknownUnknownLimited data
rOmpA/rOmpBSurface proteins involved in adhesionCell surface exposedMajor antigens, invasionHighly conserved with evidence of positive selection
Pat1 (RT0590)Patatin-like phospholipaseSecreted into host cytoplasmPhagosomal escape, cytotoxicityUbiquitous across Rickettsia species
Pat2 (RT0522)Patatin-like phospholipaseSecreted into host cytoplasmPhagosomal escape, cytotoxicityNot encoded in all Rickettsia genomes

Unlike RT0522 and RT0590, which have been demonstrated to possess phospholipase A2 activity and play roles in host cell invasion and phagosomal escape, the functional significance of RT0683 in R. typhi pathogenesis remains to be established .

Evolutionary analysis would be valuable to determine if RT0683 is under positive selection pressure like surface-exposed antigens such as rOmpA and rOmpB, which would suggest a role in host-pathogen interactions .

What challenges might arise when attempting to determine the crystal structure of RT0683?

Determining the crystal structure of RT0683 presents several technical challenges:

  • Protein expression and purification:

    • Optimizing expression conditions for high yield and proper folding

    • Ensuring homogeneity of the purified protein

    • Removal of flexible regions that might hinder crystallization

    • Addressing potential membrane-associated domains that could affect solubility

  • Crystallization hurdles:

    • Identifying optimal crystallization conditions through extensive screening

    • Dealing with potential conformational heterogeneity

    • Addressing issues of protein stability during crystallization trials

    • Consideration of fusion partners or crystallization chaperones

  • Data collection and structure solution:

    • Obtaining crystals that diffract to high resolution

    • Phasing strategies (molecular replacement may be challenging due to lack of homologous structures)

    • Need for heavy atom derivatives or selenomethionine labeling

    • Refinement challenges for novel protein folds

  • Structure validation:

    • Ensuring the biological relevance of the structure

    • Performing complementary solution studies (e.g., SAXS, NMR)

    • Functional validation of structure-derived hypotheses

Researchers should consider alternative structural approaches such as cryo-EM if crystallization proves challenging, particularly if RT0683 forms higher-order assemblies or complexes.

What is known about potential post-translational modifications of RT0683?

  • Bacterial PTMs:

    • Rickettsia species possess machinery for various PTMs including phosphorylation, glycosylation, and lipidation

    • These modifications can affect protein localization, stability, and function

  • Secretion-related processing:

    • Other Rickettsia proteins like Pat1 and Pat2 show evidence of processing during secretion

    • Western blot analysis has shown differential migration patterns between bacterial-associated and secreted forms of proteins

    • Similar processing might occur for RT0683 if it undergoes secretion

  • Analytical approaches to identify PTMs:

    • Mass spectrometry analysis of native protein extracted from R. typhi

    • Comparison with recombinant protein expressed in E. coli

    • Site-directed mutagenesis of predicted modification sites

    • Inhibitor studies targeting specific PTM pathways

  • Functional significance:

    • PTMs might regulate RT0683 activity or localization

    • Modifications could affect host immune recognition

    • Temporal regulation through reversible modifications

Future studies should incorporate these considerations when investigating the biological function of RT0683 in R. typhi.

What are the best approaches for studying potential protein-protein interactions of RT0683?

Several complementary approaches can be employed to identify and characterize potential protein-protein interactions of RT0683:

  • In vitro methods:

    • Pull-down assays using recombinant His-tagged RT0683

    • Co-immunoprecipitation with anti-RT0683 antibodies

    • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) for kinetic analysis

    • ELISA-based binding assays for screening potential partners

  • Cell-based methods:

    • Yeast two-hybrid screening

    • Bacterial two-hybrid systems

    • FRET/BRET analyses in heterologous expression systems

    • Proximity labeling approaches (BioID, APEX) if genetic manipulation of Rickettsia is feasible

  • Computational predictions:

    • Structure-based docking if structural information becomes available

    • Sequence-based interaction predictions

    • Co-expression network analysis across different Rickettsia species

    • Examination of genetic context and operonic structure

  • Validation strategies:

    • Mutational analysis of predicted interaction interfaces

    • Competition assays with peptide fragments

    • Effects of interaction disruption on protein function

    • Correlation with co-localization studies in infected cells

These approaches have been successfully applied to other Rickettsia proteins and could provide valuable insights into the functional role of RT0683.

How can I optimize expression conditions for high yields of soluble RT0683?

Optimization of expression conditions for RT0683 requires systematic evaluation of multiple parameters:

  • Expression system selection:

    • E. coli BL21(DE3) or derivatives for standard expression

    • C41/C43 strains for potentially toxic proteins

    • Arctic Express or similar strains for low-temperature expression

    • Cell-free expression systems for highly toxic proteins

  • Vector and construct design:

    • Codon optimization for E. coli expression

    • Evaluation of different tags (His, GST, MBP, SUMO) for solubility enhancement

    • Testing truncated constructs if full-length protein shows poor solubility

    • Inclusion of TEV or similar protease sites for tag removal

  • Expression parameter optimization:

    • Temperature screening (37°C, 30°C, 25°C, 18°C, 16°C)

    • IPTG concentration titration (0.1-1.0 mM)

    • Induction time optimization (2-24 hours)

    • Media composition (LB, TB, 2xYT, auto-induction media)

    • Addition of specific additives (glycerol, sorbitol, ethanol, etc.)

  • Extraction and solubilization strategies:

    • Buffer composition screening (pH, salt concentration, additives)

    • Detergent evaluation if membrane association is suspected

    • Mild solubilization from inclusion bodies if necessary

    • Refolding protocols optimization if required

  • Purification strategy optimization:

    • Buffer conditions screening for stability

    • Multiple chromatography steps evaluation

    • On-column refolding if required

A systematic approach using these strategies should be documented in a detailed laboratory notebook to identify optimal conditions for future scale-up.

What experimental controls are crucial when assessing potential functions of RT0683?

Rigorous experimental controls are essential when investigating an uncharacterized protein like RT0683:

  • Protein quality controls:

    • Purity assessment (SDS-PAGE, mass spectrometry)

    • Stability testing under experimental conditions

    • Proper folding verification (circular dichroism, thermal shift assays)

    • Batch-to-batch consistency monitoring

  • Negative controls:

    • Buffer-only controls

    • Irrelevant proteins of similar size/properties

    • Heat-inactivated RT0683

    • Pre-immune serum for antibody studies

  • Positive controls:

    • Well-characterized proteins with similar predicted functions

    • Known Rickettsia virulence factors (e.g., Pat1/Pat2 if testing phospholipase activity)

    • Domain-swapped chimeric proteins

  • Genetic controls:

    • Site-directed mutants targeting predicted active sites

    • Truncation mutants to identify functional domains

    • Complementation studies if knockout approaches are available

  • Host cell controls:

    • Multiple cell types to avoid cell-specific artifacts

    • Time-course analyses to capture temporal effects

    • Pharmacological inhibitors targeting specific cellular pathways

  • Technical controls:

    • Multiple technical replicates

    • Independent biological replicates

    • Randomization and blinding where appropriate

    • Appropriate statistical analyses

Proper implementation of these controls will strengthen the validity of functional claims about RT0683 and minimize potential artifacts.

How does RT0683 compare to homologous proteins in other Rickettsia species?

Comparative analysis of RT0683 across Rickettsia species provides insights into its evolutionary conservation and potential functional importance:

  • Sequence conservation:

    • RT0683 homologs are present across multiple Rickettsia species

    • Sequence identity/similarity varies between species groups

    • Conservation patterns might indicate functional domains

    • Synteny analysis across genomes can provide context

  • Evolutionary patterns:

    • Unlike rOmpA and rOmpB, which show evidence of positive selection and recombination , evolutionary analysis of RT0683 has not been extensively documented

    • Analysis of selection pressure (dN/dS ratios) would indicate if host immune pressure is driving evolution

    • Evidence of recombination would suggest potential advantages of genetic exchange

  • Expression patterns:

    • Transcriptional regulation might differ between species

    • Growth phase-dependent expression patterns

    • Comparison between virulent and avirulent strains

  • Potential functional differences:

    • Species-specific modifications or domains

    • Correlation with host range or tissue tropism

    • Association with different clinical manifestations

Comprehensive comparative analysis would contribute to understanding the protein's role in Rickettsia biology and pathogenesis.

What potential roles might RT0683 play in diagnostic applications for rickettsial diseases?

The potential utility of RT0683 in diagnostic applications depends on several factors:

  • Immunogenicity assessment:

    • Determine if RT0683 elicits significant antibody responses during natural infection

    • Compare antibody levels in acute versus convalescent sera

    • Evaluate cross-reactivity with antibodies against other pathogens

  • Diagnostic development potential:

    • ELISA development using recombinant RT0683 as antigen

    • Multiplex assays incorporating RT0683 with other rickettsial antigens

    • Luminex bead-based assays similar to those developed for OmpB

  • Comparison with established diagnostic antigens:

    • Sensitivity and specificity compared to OmpA and OmpB

    • Potential for improved species or group differentiation

    • Performance in various geographic regions with different Rickettsia strains

  • Technical advantages:

    • Recombinant production eliminates need for biosafety level 3 facilities

    • Standardized production ensures batch consistency

    • Potential for higher purity compared to whole-cell antigens

Recent research on recombinant protein ELISA for Rickettsia diagnosis has shown promising results with other antigens . Similar approaches could be applied to evaluate RT0683's diagnostic potential.

How does the structure-function relationship of RT0683 compare to other uncharacterized Rickettsia proteins?

A comprehensive comparison of RT0683 with other uncharacterized Rickettsia proteins would include:

  • Bioinformatic comparison:

    • Domain architecture similarities and differences

    • Predicted secondary and tertiary structures

    • Conservation of potential functional motifs

    • Genomic context and potential operonic relationships

  • Expression pattern analysis:

    • Transcriptional profiles across growth conditions

    • Co-expression networks with characterized virulence factors

    • Differential expression in various infection models

  • Experimental characterization approaches:

    • Similar methodologies can be applied across uncharacterized proteins

    • Parallel functional screening for common activities

    • Systematic localization studies

    • Interaction mapping to identify functional clusters

  • Evolutionary patterns:

    • Presence/absence across Rickettsia species

    • Evidence of horizontal gene transfer or recombination

    • Selection pressure analysis

    • Association with particular Rickettsia lineages or phenotypes

Such comparative analyses may reveal functional clusters among currently uncharacterized proteins and accelerate their functional annotation.

What emerging technologies could accelerate the functional characterization of RT0683?

Several cutting-edge technologies show promise for accelerating the functional characterization of proteins like RT0683:

  • Advanced structural approaches:

    • AlphaFold2 and similar AI-based structural prediction

    • Cryo-electron microscopy for challenging proteins

    • Integrative structural biology combining multiple data sources

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • High-throughput interaction studies:

    • Protein microarrays for systematic interaction screening

    • Deep mutational scanning to map functional residues

    • Thermal proteome profiling for target identification

    • Global bacterial two-hybrid screens

  • Advanced microscopy techniques:

    • Super-resolution microscopy for precise localization

    • Live-cell imaging with genetically encoded sensors

    • Correlative light and electron microscopy

    • Single-molecule tracking in infected cells

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Network analysis to infer function from associations

    • Machine learning for function prediction from diverse data types

    • Genome-wide CRISPR screens in host cells

  • Genetic manipulation advances:

    • Improved transformation efficiency for Rickettsia

    • CRISPR-based approaches for rickettsial genome editing

    • Conditional expression systems for essential genes

    • Single-cell analysis of infected host cells

These technologies, when applied systematically, could rapidly advance our understanding of RT0683 function in Rickettsia biology.

What potential role might RT0683 play in the pathogenesis of R. typhi infection?

Investigation of RT0683's potential role in pathogenesis should consider several hypotheses:

  • Potential functions based on sequence analysis:

    • Transmembrane regions suggest possible membrane localization

    • Analysis for known functional motifs and domains

    • Comparison with virulence factors of other intracellular pathogens

  • Localization and timing studies:

    • Expression patterns during infection cycle

    • Potential secretion into host cells (similar to Pat1/Pat2)

    • Association with specific subcellular compartments

  • Interaction with host cell processes:

    • Effects on host cell signaling pathways

    • Modulation of host immune responses

    • Interference with vesicular trafficking

    • Alteration of host cell metabolism

  • Potential roles in key pathogenic processes:

    • Cell invasion

    • Phagosomal escape

    • Intracellular survival and replication

    • Cell-to-cell spread

    • Modulation of host cell death pathways

  • Experimental approaches to test hypotheses:

    • Neutralization studies with anti-RT0683 antibodies

    • Expression of protein in heterologous systems

    • Complementation studies with related rickettsial species

    • Host cell response to purified recombinant protein

Systematic investigation of these aspects would provide insights into the potential contribution of RT0683 to R. typhi pathogenesis and may reveal novel therapeutic targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.